Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40402
         (371 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M29488-1|AAA27723.1|   86|Apis mellifera protein ( Bee homeobox-...    21   3.5  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    21   4.7  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    21   4.7  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    21   4.7  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   6.2  

>M29488-1|AAA27723.1|   86|Apis mellifera protein ( Bee
          homeobox-containing gene,partial cds, clone H55. ).
          Length = 86

 Score = 21.4 bits (43), Expect = 3.5
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +3

Query: 42 NQNGDSKSKKCSAEKYQT 95
          N NG+ K ++ S  +YQT
Sbjct: 3  NANGEVKRQRTSYTRYQT 20


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.0 bits (42), Expect = 4.7
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 192 HSWRPDXVL 166
           H WRPD VL
Sbjct: 109 HIWRPDIVL 117


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.0 bits (42), Expect = 4.7
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 192 HSWRPDXVL 166
           H WRPD VL
Sbjct: 109 HIWRPDIVL 117


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 21.0 bits (42), Expect = 4.7
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 192 HSWRPDXVL 166
           H WRPD VL
Sbjct: 105 HIWRPDIVL 113


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 20.6 bits (41), Expect = 6.2
 Identities = 14/48 (29%), Positives = 20/48 (41%)
 Frame = +3

Query: 36  SKNQNGDSKSKKCSAEKYQTHXTRPHQSHKMRIVYKSXKMPRVLVRDL 179
           S  + GD+    CSA   Q H  R  +S  + ++      P    RDL
Sbjct: 577 SVQKKGDAGVYTCSARNKQGHSAR--RSGDVAVIVPPKISPFTADRDL 622


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,163
Number of Sequences: 438
Number of extensions: 1430
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8928360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)