Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40386
         (615 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0191 - 32228642-32228949,32229028-32230567                       28   5.1  

>03_06_0191 - 32228642-32228949,32229028-32230567
          Length = 615

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 4/62 (6%)
 Frame = +2

Query: 233 KRGSKKEILSRPNCI----S*IESHLILVSCELDAFITEYIIDTISQIEIQGNLKFHNQV 400
           K+G+ K  LS  +CI      + SH+IL+ C +D    +  I+ I  I    +  F N +
Sbjct: 512 KQGNFKGALSVLSCIPSNVESVNSHVILLKCLIDVGEVDLAIEHIKSIRSNFSSSFQNII 571

Query: 401 SK 406
           ++
Sbjct: 572 NE 573


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,752,831
Number of Sequences: 37544
Number of extensions: 201677
Number of successful extensions: 315
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 311
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 315
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1478421500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)