SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40383
         (630 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0379 - 2723365-2723490,2724558-2724647,2724813-2725046,272...    28   5.3  

>06_01_0379 -
           2723365-2723490,2724558-2724647,2724813-2725046,
           2725174-2725470
          Length = 248

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 13/48 (27%), Positives = 25/48 (52%)
 Frame = -1

Query: 312 PPRFLIQLNLYIGVPSWLINIFCMLRCKYLLFFNFSHENVLRSMCIQY 169
           PP F++QL   + V    +     L  ++L+++ F  +N + S+C  Y
Sbjct: 140 PPLFMVQLGPVLFVRDTTLLFPVHLSKRHLIWYGFERKNGVHSVCPAY 187


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,582,447
Number of Sequences: 37544
Number of extensions: 227597
Number of successful extensions: 362
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 358
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 362
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1537558360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -