BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40324 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces p... 28 1.5 SPAC3A11.14c |pkl1|klp1, SPAC3H5.03c|kinesin-like protein Pkl1|S... 27 2.0 SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit ... 26 6.2 SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual 26 6.2 SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra... 25 8.2 >SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 309 Score = 27.9 bits (59), Expect = 1.5 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +3 Query: 357 DAVSGIGTDEEAIIEILCTLSNYGIRTISAFYEQLYGKSLESD 485 DA++ + +E I E T +Y IRT+S Y+ Y S D Sbjct: 215 DAITSLWDPQELICERSITRMDYPIRTLSFSYDSRYLASGSED 257 >SPAC3A11.14c |pkl1|klp1, SPAC3H5.03c|kinesin-like protein Pkl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 832 Score = 27.5 bits (58), Expect = 2.0 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +3 Query: 450 YEQLYGKS--LESDLKGDTSGHSRDCACRCAWPIAMKTRASMKAQLKPMLKHWPPLVK 617 YE K+ L+SD+ G +RD A PIA ++ + + + W P +K Sbjct: 50 YENFVSKNHVLQSDINGKKRDSNRDKAAVVTAPIASTHESNYEESVSKFKESWLPQLK 107 >SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit Bdp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 507 Score = 25.8 bits (54), Expect = 6.2 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 620 QWGTDESIFNSILITRSYQQLRQIFAEYE 706 QWGTD ++ ++ TR+ +Q++ F + E Sbjct: 382 QWGTDFALIANMFPTRNRRQIKLKFKQEE 410 >SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1339 Score = 25.8 bits (54), Expect = 6.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 446 ILRTTVRQEPGIGLKRRHVG 505 ++ T + +PG LK+RH+G Sbjct: 1171 MMPTNIEHDPGCTLKKRHIG 1190 >SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating transcription Rct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 25.4 bits (53), Expect = 8.2 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +3 Query: 492 GDTSGHSRDCACRCAWPIAMKTRASMKAQLKPMLKH 599 GD G + D RC W + K KA+ P L H Sbjct: 54 GDPLGPTGDGG-RCVWNVLNKGTRFFKAEFNPSLVH 88 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,671,582 Number of Sequences: 5004 Number of extensions: 51409 Number of successful extensions: 158 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -