BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40320 (738 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1049 + 23944526-23945473 29 2.9 10_08_0977 - 21985149-21985277,21985348-21985722,21985824-219858... 28 8.9 >08_02_1049 + 23944526-23945473 Length = 315 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 268 WEGIGLDITALAISSTASLRTCAFSCRSKYMKL 170 WE + D+ A +S A+LR CR K KL Sbjct: 58 WEEVAADVAARCAASGAALRKTGTQCRHKLEKL 90 >10_08_0977 - 21985149-21985277,21985348-21985722,21985824-21985874, 21985964-21986189,21986289-21986359,21986430-21986549, 21986641-21986835,21986921-21986985,21987894-21987984, 21988700-21988761,21988854-21988904,21989172-21989273, 21989873-21989980,21990071-21990134,21990246-21990392 Length = 618 Score = 27.9 bits (59), Expect = 8.9 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 90 LVDLICEVLTLCFEKFSPGEVIKSFTGN--FMYLLRHENAHVRRLA 221 LVD+ LT+ F + P EV K+ TGN + R+ +AH RR+A Sbjct: 485 LVDMESAYLTVEFFRKLPQEVDKTGTGNPSTPSVDRYADAHFRRIA 530 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,696,090 Number of Sequences: 37544 Number of extensions: 336291 Number of successful extensions: 763 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -