BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40320 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 26 1.4 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 25 1.8 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 335 QRLYHYHQQADQQLHTHQY 279 Q+ +H+HQ QQ H QY Sbjct: 308 QQQHHHHQHQPQQQHQQQY 326 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 533 KSNLLMYCTN*IFWNSCQPWQSNHTVLITYSIVEQ 637 KSN+L+Y + W +QS+ T+ +TY +Q Sbjct: 128 KSNVLIYPNGEVLWVPPAIYQSSCTIDVTYFPFDQ 162 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,317 Number of Sequences: 2352 Number of extensions: 15369 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -