BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40320 (738 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF077533-2|AAP40529.1| 972|Caenorhabditis elegans Hypothetical ... 31 0.85 AF077533-1|AAZ91357.1| 1126|Caenorhabditis elegans Hypothetical ... 31 0.85 AF077534-7|AAK71376.1| 319|Caenorhabditis elegans Prion-like-(q... 29 4.5 Z70780-8|CAA94825.2| 266|Caenorhabditis elegans Hypothetical pr... 28 7.9 >AF077533-2|AAP40529.1| 972|Caenorhabditis elegans Hypothetical protein F54G2.1b protein. Length = 972 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/66 (24%), Positives = 31/66 (46%) Frame = +3 Query: 78 FDRHLVDLICEVLTLCFEKFSPGEVIKSFTGNFMYLLRHENAHVRRLAVDEIAKAVISSP 257 + R LVD+ICE++T+ +K G + FT + + H+ A++ + S Sbjct: 716 YTRQLVDVICEIVTVYTQKIISGLEAEGFTQELQAFIPSQLLHLLCAAINNCEQVRRSLN 775 Query: 258 MPSQYH 275 + + H Sbjct: 776 ITEKLH 781 >AF077533-1|AAZ91357.1| 1126|Caenorhabditis elegans Hypothetical protein F54G2.1a protein. Length = 1126 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/66 (24%), Positives = 31/66 (46%) Frame = +3 Query: 78 FDRHLVDLICEVLTLCFEKFSPGEVIKSFTGNFMYLLRHENAHVRRLAVDEIAKAVISSP 257 + R LVD+ICE++T+ +K G + FT + + H+ A++ + S Sbjct: 700 YTRQLVDVICEIVTVYTQKIISGLEAEGFTQELQAFIPSQLLHLLCAAINNCEQVRRSLN 759 Query: 258 MPSQYH 275 + + H Sbjct: 760 ITEKLH 765 >AF077534-7|AAK71376.1| 319|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 48 protein. Length = 319 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 323 HYHQQADQQLHTHQ 282 HYHQQ QQ H HQ Sbjct: 47 HYHQQQQQQQHAHQ 60 >Z70780-8|CAA94825.2| 266|Caenorhabditis elegans Hypothetical protein F46B6.9 protein. Length = 266 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/63 (31%), Positives = 31/63 (49%) Frame = -3 Query: 334 NAYIIITNKLTNSYIHINILWYWEGIGLDITALAISSTASLRTCAFSCRSKYMKLPVKLL 155 NA + N L +S I + Y G + +T L + T +SCR+K+MK + + Sbjct: 44 NAIDFVVNHLKSSDHRIKLYVY--GCVVLVTILHVMFTCLSLYGIYSCRAKFMKPLIVDI 101 Query: 154 ITS 146 ITS Sbjct: 102 ITS 104 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,388,835 Number of Sequences: 27780 Number of extensions: 338147 Number of successful extensions: 799 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1735436670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -