BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40320 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 25 0.56 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 22 6.9 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 6.9 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 9.1 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 25.4 bits (53), Expect = 0.56 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 533 KSNLLMYCTN*IFWNSCQPWQSNHTVLITYSIVEQ 637 KSN+L+Y + W +QS+ T+ +TY +Q Sbjct: 128 KSNVLIYPNGDVLWVPPAIYQSSCTIDVTYFPFDQ 162 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 21.8 bits (44), Expect = 6.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 21 ISETILEVGLSKILQCF 71 IS+ + + +SKI QCF Sbjct: 107 ISDANVHIKISKIFQCF 123 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.8 bits (44), Expect = 6.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 722 PNNFM*PGINIPPTG 678 P N+M P I+I P G Sbjct: 523 PRNYMYPNIDISPEG 537 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 566 IFWNSCQPWQSNHTVLITYSIVEQWIN 646 ++W+ ++ L Y +VE+W+N Sbjct: 172 LYWDQEPIILADELHLTEYKLVEKWVN 198 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,431 Number of Sequences: 438 Number of extensions: 3948 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -