BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40319 (775 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 26 1.5 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 6.0 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 25.8 bits (54), Expect = 1.5 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -2 Query: 309 NLEHLIVIGKRDGTSMNT*FPLSRAPFRVSD*MQKNCQPTRSRVTSHQSS 160 N++H+IV G D +MN + L F D + P R+ + H ++ Sbjct: 93 NIKHIIVCGHSDCKAMNLLYKLKDPEFASLD--NRRISPLRAWLCEHANT 140 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 621 VRIPQRVPIFPMKYLLNKWFTIDFHGEGITSW 716 V +PQR + + Y +++ FT+ F E + W Sbjct: 1327 VHLPQRPILQDILYYMDRIFTVIFFLEMLIKW 1358 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 813,394 Number of Sequences: 2352 Number of extensions: 15397 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -