BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40318 (613 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08) 29 3.9 SB_52287| Best HMM Match : Myb_DNA-binding (HMM E-Value=4.5) 27 9.1 >SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08) Length = 1907 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 376 VLNVFGKAF*IIVREKFDQSRSKPERYVH*CFVLVSFVSELYRH 245 +++V G+ ++ +K DQ R + +R L SFV LYRH Sbjct: 442 LVHVMGRKDEVVSSQKHDQLRQQLQRTSDRQLSLYSFVMSLYRH 485 >SB_52287| Best HMM Match : Myb_DNA-binding (HMM E-Value=4.5) Length = 529 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 406 SKCKYLPLLPPYVPFTKNITFFFIKCH 486 ++C + LLP P T N+ F + CH Sbjct: 141 NECTLVCLLPAAQPLTYNVRFTLVHCH 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,011,456 Number of Sequences: 59808 Number of extensions: 278646 Number of successful extensions: 615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -