BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40318 (613 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82280-5|CAB05266.1| 294|Caenorhabditis elegans Hypothetical pr... 28 6.0 U80441-12|ABE73337.1| 147|Caenorhabditis elegans Hypothetical p... 28 6.0 >Z82280-5|CAB05266.1| 294|Caenorhabditis elegans Hypothetical protein R05A10.5 protein. Length = 294 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +1 Query: 397 CVLSKCKY---LPLLPPYVPFTKNITF 468 C LS CKY PPYVP N TF Sbjct: 81 CNLSACKYPAQKTCCPPYVPMVLNSTF 107 >U80441-12|ABE73337.1| 147|Caenorhabditis elegans Hypothetical protein F27C1.13 protein. Length = 147 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -2 Query: 603 INAYLIIDKRFKGHRTLVHRHQNIHIILLLDDMKRSIFI 487 I Y D + GHR V H+ + +L+DD+ R++++ Sbjct: 46 ITIYKENDTFYTGHRVPVSNHRYKTLDVLMDDLNRTMYL 84 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,834,934 Number of Sequences: 27780 Number of extensions: 237118 Number of successful extensions: 619 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -