BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40314 (725 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 24 1.1 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 3.3 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/60 (16%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +2 Query: 464 NLAYFLHRMYLNF**NNVVRAFYVRYIRSHNVLHERKLLGS-FYT*MYFVDIMFIIIFLY 640 +L+YF+ +Y N + ++ ++ + +L RK+ + +Y ++ +++++++ Y Sbjct: 58 DLSYFISNVYQILAYNFWKKKYWSEFLANLKLLKGRKIRKNLYYLLLFVINVLYVLTLCY 117 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 572 FFHVKHYASEYILHKKPVRRYFTRNLNTYGVENKRDCSWRS 450 FF + +E +KP+R F + Y VE K WR+ Sbjct: 301 FFEIDRINAE---SRKPIRILFDVSSEIYNVEYKNVEFWRN 338 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,487 Number of Sequences: 336 Number of extensions: 3576 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -