BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40313 (495 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 27 0.14 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 0.77 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 4.1 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 5.4 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.5 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 26.6 bits (56), Expect = 0.14 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 79 SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 189 +DT+ K KI K I PD + L+ KQ E G TL Sbjct: 732 TDTVLAYKPKILGKPTISPDSRHLVTLDKQ-ETGVTL 767 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 24.2 bits (50), Expect = 0.77 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +3 Query: 75 SFRHYRKCQS*NPRQGRYSSRPTTSHLCRETIRRWPHS 188 S +H KC + +SS P +H CR W HS Sbjct: 162 SVKHVAKCAT------DFSSWPYDTHRCRINFGSWVHS 193 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 213 IHTSPGFET*RRYNEPSLR 269 IH P RRYN PS R Sbjct: 346 IHVLPRLLVMRRYNTPSKR 364 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 5.4 Identities = 5/8 (62%), Positives = 8/8 (100%) Frame = -1 Query: 279 WRECEGKV 256 W++CEGK+ Sbjct: 200 WKQCEGKI 207 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 81 GSFHLQCNGLPRKGFDEY 28 G+ +Q P KGF+EY Sbjct: 394 GTLSVQPQANPVKGFEEY 411 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,913 Number of Sequences: 438 Number of extensions: 3152 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13667319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -