BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40312 (649 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 28 1.3 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 25 7.1 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 638 HVFVRLYTHTEICSEKNLLRKPFHR*E*TFN*QSLF 531 H FV L++HT + S+ L+ P+H TF ++ F Sbjct: 41 HAFVFLFSHTLVSSQFRRLKLPYHH-HHTFTIEAFF 75 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 381 HKL*QISFFNYSFYIEYHVSRSWY 452 H+L ++ + N +FY Y+ SRSW+ Sbjct: 488 HRLPEVQW-NRAFYKTYYESRSWF 510 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,227,644 Number of Sequences: 5004 Number of extensions: 41145 Number of successful extensions: 84 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -