BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40312 (649 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z47358-7|CAA87435.1| 369|Caenorhabditis elegans Hypothetical pr... 29 2.1 U50311-6|AAA92310.2| 496|Caenorhabditis elegans Cytochrome p450... 28 6.6 >Z47358-7|CAA87435.1| 369|Caenorhabditis elegans Hypothetical protein ZK1307.9 protein. Length = 369 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = -1 Query: 619 IPIQKSVPKKTY*ESRFIAENKPSINNPYSVISERY 512 + I+K+ P+ + + A KP+I+NP S+I++ Y Sbjct: 326 VQIKKAAPENSSLQDEEPAVEKPNISNPISLIAQEY 361 >U50311-6|AAA92310.2| 496|Caenorhabditis elegans Cytochrome p450 family protein 33B1 protein. Length = 496 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 539 IVN*RFILSDETAFLVGFFRNRFLYGYKVLQTHVF 643 I+N F+L E VG N+FL+GY+ ++ +F Sbjct: 161 ILNEDFLLQSELDVAVGSVINQFLFGYRFDRSKLF 195 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,966,114 Number of Sequences: 27780 Number of extensions: 213801 Number of successful extensions: 385 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -