BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40311 (668 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 2.2 AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. 24 5.0 AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 23 6.6 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 23 8.7 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 23 8.7 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 135 ACRTLGDDCL*IRNKWELGKDIESLLWAYSCRRS 34 A + L DDCL R + +L D+E A + R+ Sbjct: 369 AIKRLRDDCLAARERVQLSHDLEERSMAAAAHRT 402 >AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. Length = 94 Score = 23.8 bits (49), Expect = 5.0 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 88 PFITDSQTIVSKCSASTIYRATCPLRTCSPYFRSRTG*RR 207 PF S +V++ ++ + TC TCS R R G RR Sbjct: 43 PFQMASAPLVAQSRSAMVQTLTCTNPTCSAQCRGR-GYRR 81 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 61 KTLYIFSKLPFITDSQTIVSKCSASTIYRATC 156 K + F K+P ITDSQ + + I+R C Sbjct: 48 KAINRFQKVPCITDSQ--IKLAESVAIFRYLC 77 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 23.0 bits (47), Expect = 8.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 162 QGTRCSVDCACRTLG 118 QGT C+ DC R +G Sbjct: 57 QGTVCAFDCTYREMG 71 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 23.0 bits (47), Expect = 8.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 162 QGTRCSVDCACRTLG 118 QGT C+ DC R +G Sbjct: 206 QGTVCAFDCTYREMG 220 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,985 Number of Sequences: 2352 Number of extensions: 11089 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -