BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40309 (850 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 29 5.2 At1g67830.1 68414.m07742 GDSL-motif lipase/hydrolase family prot... 28 6.8 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 28.7 bits (61), Expect = 5.2 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = -1 Query: 508 PSPSSST*EVFDSSVCVSFGLGHISTQLQHSLYKELRQLKQSLQHEQSFKSHLHDWVNMH 329 P PS + FD S C S +G+I TQ+ L +E+ ++ + + + +H Sbjct: 43 PVPSGNLPPGFDPSTCRSVYVGNIHTQVTEPLLQEIFTSTGPVESSKLIRKDKSSYGFVH 102 Query: 328 -FDTTLAHIASL 296 FD A +A L Sbjct: 103 YFDRRSAALAIL 114 >At1g67830.1 68414.m07742 GDSL-motif lipase/hydrolase family protein similar to early nodulin ENOD8 [Medicago sativa] GI:304037, elicitor-induced glycoprotein iEP4 [Daucus carota] GI:1911765, lanatoside 15'-O-acetylesterase [Digitalis lanata] GI:3688284; contains Pfam profile PF00657: Lipase/Acylhydrolase with GDSL-like motif Length = 372 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -1 Query: 478 FDSSVCVSFGLGHISTQLQHSLYKELRQLKQSL 380 FDS CVS L H++ Q H+L + + +L+ SL Sbjct: 239 FDSHGCVS-PLNHLAQQFNHALKQAVIELRSSL 270 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,446,814 Number of Sequences: 28952 Number of extensions: 342221 Number of successful extensions: 890 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 890 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -