BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40303 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_4971| Best HMM Match : Ras (HMM E-Value=0) 69 5e-12 SB_44625| Best HMM Match : Ras (HMM E-Value=0) 68 8e-12 SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) 65 4e-11 SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) 64 1e-10 SB_10811| Best HMM Match : Ras (HMM E-Value=0) 64 1e-10 SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50523| Best HMM Match : Ras (HMM E-Value=0) 60 1e-09 SB_27557| Best HMM Match : Ras (HMM E-Value=0) 60 2e-09 SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_13045| Best HMM Match : Ras (HMM E-Value=0) 58 6e-09 SB_50855| Best HMM Match : Ras (HMM E-Value=0) 58 9e-09 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 56 3e-08 SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_7589| Best HMM Match : Ras (HMM E-Value=0) 54 1e-07 SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30) 53 2e-07 SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) 53 2e-07 SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35) 52 6e-07 SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) 51 7e-07 SB_8315| Best HMM Match : Ras (HMM E-Value=0) 51 7e-07 SB_36483| Best HMM Match : Ras (HMM E-Value=0) 51 1e-06 SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) 44 1e-04 SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11841| Best HMM Match : Ras (HMM E-Value=0) 43 2e-04 SB_54971| Best HMM Match : Ras (HMM E-Value=0) 41 8e-04 SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10) 40 0.002 SB_1071| Best HMM Match : Ras (HMM E-Value=0) 40 0.002 SB_38511| Best HMM Match : Ras (HMM E-Value=1.2e-22) 39 0.004 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 39 0.004 SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) 38 0.006 SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_1277| Best HMM Match : DAO (HMM E-Value=6e-32) 37 0.013 SB_58217| Best HMM Match : Ras (HMM E-Value=0.00048) 36 0.030 SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) 35 0.069 SB_2880| Best HMM Match : Ras (HMM E-Value=3.2e-17) 35 0.069 SB_37276| Best HMM Match : Ras (HMM E-Value=0.00045) 35 0.069 SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 33 0.16 SB_31439| Best HMM Match : Ras (HMM E-Value=4.7) 33 0.16 SB_288| Best HMM Match : Ras (HMM E-Value=1.5e-11) 33 0.16 SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) 33 0.28 SB_53183| Best HMM Match : Ras (HMM E-Value=0) 32 0.37 SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) 32 0.37 SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_12958| Best HMM Match : Ras (HMM E-Value=6e-13) 32 0.49 SB_925| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=0.62) 31 0.64 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 31 0.85 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 31 1.1 SB_57342| Best HMM Match : Arf (HMM E-Value=0) 31 1.1 SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_31326| Best HMM Match : rve (HMM E-Value=6.1e-07) 30 1.5 SB_43575| Best HMM Match : Sina (HMM E-Value=0) 30 1.5 SB_53279| Best HMM Match : rve (HMM E-Value=5.2e-36) 30 2.0 SB_49675| Best HMM Match : rve (HMM E-Value=5.2e-36) 30 2.0 SB_48115| Best HMM Match : rve (HMM E-Value=5.3e-36) 30 2.0 SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 30 2.0 SB_30405| Best HMM Match : rve (HMM E-Value=5.1e-07) 30 2.0 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 30 2.0 SB_15390| Best HMM Match : rve (HMM E-Value=5.2e-36) 30 2.0 SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) 30 2.0 SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_35114| Best HMM Match : RVT_1 (HMM E-Value=2.2e-11) 30 2.0 SB_9297| Best HMM Match : RVT_1 (HMM E-Value=7e-21) 30 2.0 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 30 2.0 SB_30773| Best HMM Match : rve (HMM E-Value=0.0063) 29 2.6 SB_37042| Best HMM Match : Arf (HMM E-Value=0) 29 3.4 SB_9645| Best HMM Match : DUF101 (HMM E-Value=4.3) 29 3.4 SB_53792| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) 29 3.4 SB_42776| Best HMM Match : rve (HMM E-Value=1.4e-24) 29 3.4 SB_40202| Best HMM Match : Peptidase_M56 (HMM E-Value=4.4) 29 4.5 SB_29802| Best HMM Match : Laminin_EGF (HMM E-Value=0) 28 6.0 SB_25282| Best HMM Match : rve (HMM E-Value=6.3e-12) 28 6.0 SB_22497| Best HMM Match : Ras (HMM E-Value=7.7e-07) 28 6.0 SB_44983| Best HMM Match : Death (HMM E-Value=4.8e-09) 28 7.9 SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) 28 7.9 >SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 79.0 bits (186), Expect = 3e-15 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQE 252 KLQLWDTAGQERFRKSMV HYYRNV+AVV +YD+T+ +F +++ W+ E Sbjct: 96 KLQLWDTAGQERFRKSMVCHYYRNVNAVVFMYDITRKCSFEALTTWIVE 144 Score = 68.5 bits (160), Expect = 5e-12 Identities = 30/67 (44%), Positives = 46/67 (68%) Frame = +3 Query: 273 NAPRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTLAHK 452 + P++L+GNKCD G E +++ A++ AD + MPL+E S D+E + +E+IFLTL HK Sbjct: 153 DVPKILIGNKCDLGL-ERTVSSNIARKFADSHNMPLWEISIKNDAELEQIEAIFLTLTHK 211 Query: 453 LYSKQPL 473 L +PL Sbjct: 212 LLKHKPL 218 >SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 70.9 bits (166), Expect = 9e-13 Identities = 28/54 (51%), Positives = 41/54 (75%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEMN 258 K KLQ+WDTAGQERFR ++ YYR H +++VYDVT E+F+++ W+QE++ Sbjct: 76 KTIKLQIWDTAGQERFR-TITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEID 128 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/64 (37%), Positives = 37/64 (57%) Frame = +3 Query: 273 NAPRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTLAHK 452 N ++LVGNKCD T + + T A+ A+ G+P ETSA NVE F+T+A + Sbjct: 134 NVNKLLVGNKCDL-TTKKVVDFTTAKEYAESLGVPFLETSA---KNATNVEQAFMTMAAE 189 Query: 453 LYSK 464 + ++ Sbjct: 190 IKNR 193 >SB_4971| Best HMM Match : Ras (HMM E-Value=0) Length = 209 Score = 68.5 bits (160), Expect = 5e-12 Identities = 28/54 (51%), Positives = 41/54 (75%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEMN 258 K KLQ+WDTAGQERFR ++ YYR+ H +V++YDV + ETF +S W++E++ Sbjct: 55 KTIKLQIWDTAGQERFR-TLTTAYYRSAHGIVLIYDVNESETFLHLSQWLEEVS 107 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/60 (38%), Positives = 34/60 (56%) Frame = +3 Query: 285 VLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTLAHKLYSK 464 +LVGNKCD ++ A+ A+K + ETSA + NVES+F T+A +L +K Sbjct: 117 ILVGNKCDL-IDCRQVGYNTAKEFAEKLDISFIETSA---KDSTNVESVFRTMAAELKAK 172 >SB_44625| Best HMM Match : Ras (HMM E-Value=0) Length = 128 Score = 67.7 bits (158), Expect = 8e-12 Identities = 27/51 (52%), Positives = 38/51 (74%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEMN 258 KLQ+WDTAGQERFR ++ YYR H V++VYDVT +TF ++ W+ E++ Sbjct: 27 KLQIWDTAGQERFR-TITSTYYRGTHGVIVVYDVTSADTFVNVKRWLHEID 76 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 282 RVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSA 395 R+LVGNK DC + + + T Q+ ++ + +FETSA Sbjct: 84 RILVGNKDDCPS-KKVVETADLQKFGEQMNIRVFETSA 120 >SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 66.9 bits (156), Expect = 1e-11 Identities = 29/59 (49%), Positives = 40/59 (67%) Frame = +1 Query: 82 DIPGLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEMN 258 D+ G K K LQ+WDTAGQERFR S+ Q YY N V++ YD+T ++F S+ W+ + N Sbjct: 50 DVDGEKVK-LQIWDTAGQERFR-SITQSYYHNADGVIVTYDITNKKSFESLPQWLDDTN 106 >SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) Length = 241 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/54 (50%), Positives = 41/54 (75%) Frame = +1 Query: 94 LKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 L+ KLQ+WDTAGQERFR ++ Q YYR+ + V+I YD+TK +TF ++ W +++ Sbjct: 92 LQDVKLQIWDTAGQERFR-TITQSYYRSCNGVIIAYDITKCDTFKNVIRWGEDV 144 >SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) Length = 421 Score = 64.1 bits (149), Expect = 1e-10 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 K K +WDTAGQERF KS+ YYR+ A ++VYD+T TFHS+ W++E+ Sbjct: 7 KAYKFNIWDTAGQERF-KSLAPLYYRDAAAAILVYDITIESTFHSLRPWIREL 58 >SB_10811| Best HMM Match : Ras (HMM E-Value=0) Length = 304 Score = 63.7 bits (148), Expect = 1e-10 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = +1 Query: 91 GLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQE 252 G K KLQ+WDTAGQERFR S+ + YYR ++VYD++ ETF+S++ W+ + Sbjct: 140 GGKSVKLQIWDTAGQERFR-SVTRSYYRGAAGALLVYDISSRETFNSLTNWLTD 192 >SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 62.9 bits (146), Expect = 2e-10 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = +1 Query: 82 DIPGLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 DI G + KLQ WDTAGQE+FR + Q YYRN AV++V+D+T TF SI W+ + Sbjct: 54 DIHG-DRVKLQCWDTAGQEKFR-GITQSYYRNADAVILVFDITNRGTFASIPQWLMNV 109 Score = 35.1 bits (77), Expect = 0.052 Identities = 26/69 (37%), Positives = 33/69 (47%) Frame = +3 Query: 273 NAPRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTLAHK 452 N +VLVGNK D ++ T A LA+ + ETSA D DNVE + LA + Sbjct: 116 NILKVLVGNKTDLKGASRKVNTRSAANLAEFEELLYLETSAKWD---DNVEVLIAELAEQ 172 Query: 453 LYSKQPLRV 479 L RV Sbjct: 173 LRENAKNRV 181 >SB_50523| Best HMM Match : Ras (HMM E-Value=0) Length = 154 Score = 60.5 bits (140), Expect = 1e-09 Identities = 25/54 (46%), Positives = 40/54 (74%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEMN 258 K+ KLQ+WDTAGQERF ++ YYR +++VYDVT ++F +IS W+++++ Sbjct: 3 KKIKLQIWDTAGQERFH-TITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKID 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/67 (35%), Positives = 36/67 (53%) Frame = +3 Query: 255 ESHGLMNAPRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIF 434 + H + R+LVGNKCD + ++ T ++LA YG+ ETSAL + NVE F Sbjct: 55 DDHANEDVKRMLVGNKCDM-YDKRVISQTKGEQLASSYGISFIETSALSNI---NVEKSF 110 Query: 435 LTLAHKL 455 + L + Sbjct: 111 VVLTEDI 117 >SB_27557| Best HMM Match : Ras (HMM E-Value=0) Length = 184 Score = 60.1 bits (139), Expect = 2e-09 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = +1 Query: 82 DIPGLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEMNP 261 ++ G + KLQ+WDTAGQERFR S+ YYRN +I+YD+T ++F ++ W +E Sbjct: 56 ELKGDVRIKLQIWDTAGQERFR-SITYSYYRNTVGCLIIYDITNRDSFVNVMDWYKEAKQ 114 Query: 262 MV 267 V Sbjct: 115 CV 116 >SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 58.8 bits (136), Expect = 4e-09 Identities = 24/50 (48%), Positives = 32/50 (64%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 KL +WDTAGQERFR ++ YYR V++VYD ETF + W+ E+ Sbjct: 58 KLAIWDTAGQERFR-TLTPSYYRGAQGVILVYDTNSRETFDKLEEWLNEV 106 >SB_13045| Best HMM Match : Ras (HMM E-Value=0) Length = 629 Score = 58.0 bits (134), Expect = 6e-09 Identities = 24/50 (48%), Positives = 34/50 (68%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 K Q+WDTAGQER+R ++ YYR V+VYD+TK +TF + W+ E+ Sbjct: 62 KAQVWDTAGQERYR-AITSAYYRGAVGAVLVYDLTKQKTFQDVERWLLEV 110 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 285 VLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSAL 398 +LVGNKCD + +A+ A++ D++G+ E SAL Sbjct: 121 MLVGNKCDLKHLRA-VASDDAKKYGDEHGLAFIEASAL 157 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 57.6 bits (133), Expect = 9e-09 Identities = 22/50 (44%), Positives = 33/50 (66%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 K ++WDTAGQER+ S+ YYR A ++VYD+T +TF W++E+ Sbjct: 71 KFEIWDTAGQERYH-SLAPMYYRGAQAAIVVYDITNQDTFARAKTWVKEL 119 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 55.6 bits (128), Expect = 3e-08 Identities = 23/46 (50%), Positives = 32/46 (69%) Frame = +1 Query: 109 LQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWM 246 +QLWDTAGQERFR S+ + Y+R ++I YDVT +F ++ WM Sbjct: 947 IQLWDTAGQERFR-SITKQYFRKADGILIFYDVTAESSFTNLKKWM 991 >SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 54.0 bits (124), Expect = 1e-07 Identities = 22/48 (45%), Positives = 34/48 (70%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQ 249 +LQ+WDTAGQERFR ++ Y R+ A +IV+D+T +F S+ W++ Sbjct: 213 RLQIWDTAGQERFR-CLIHSYIRDSEAALIVFDITNYTSFESVGDWVK 259 >SB_7589| Best HMM Match : Ras (HMM E-Value=0) Length = 640 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQ 249 K LQLWDTAGQERFR S+ + Y+R V+++YDVT +F + W++ Sbjct: 489 KTYALQLWDTAGQERFR-SIAKSYFRKADGVLLLYDVTCETSFLDVRDWVE 538 >SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30) Length = 517 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/46 (47%), Positives = 34/46 (73%) Frame = +1 Query: 118 WDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 W+ AGQERFR ++ YYR H V+IVYD+TK E+++++ W+ E+ Sbjct: 374 WE-AGQERFR-TITSSYYRGAHGVMIVYDITKRESYNNLHKWLMEV 417 >SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) Length = 115 Score = 52.8 bits (121), Expect = 2e-07 Identities = 21/46 (45%), Positives = 33/46 (71%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSI 234 K+ KLQ+WDTAGQER+R ++ YYR +++YD+T E+F ++ Sbjct: 68 KRVKLQIWDTAGQERYR-TITTAYYRGAMGFILMYDITNEESFQAV 112 >SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35) Length = 145 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/46 (45%), Positives = 32/46 (69%) Frame = +1 Query: 115 LWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQE 252 +WDTAGQERF+ S+ +YR V+V+DVT+P +F ++ +W E Sbjct: 1 IWDTAGQERFQ-SLGVAFYRGADCCVLVFDVTQPNSFKTLDSWRDE 45 >SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) Length = 212 Score = 51.2 bits (117), Expect = 7e-07 Identities = 21/54 (38%), Positives = 35/54 (64%) Frame = +1 Query: 91 GLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQE 252 G KQ L +WDTAG ERFR ++ ++YYR HA +++++V P + + W+ + Sbjct: 56 GEKQVTLSVWDTAGVERFR-TVTKNYYRGAHACILMFNVDDPGSLQYLLHWIHD 108 >SB_8315| Best HMM Match : Ras (HMM E-Value=0) Length = 565 Score = 51.2 bits (117), Expect = 7e-07 Identities = 21/49 (42%), Positives = 35/49 (71%) Frame = +1 Query: 109 LQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 LQLWDTAGQERFR S+ ++R+ ++V+D+T ++F +I W+ ++ Sbjct: 168 LQLWDTAGQERFR-SLTTAFFRDAMGFLLVFDLTHEQSFVNIRNWLSQL 215 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 285 VLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSA 395 VL+GNK D + + A+ LAD G+ FETSA Sbjct: 470 VLLGNKADL-EDDRVVDEAEARALADNLGLKYFETSA 505 >SB_36483| Best HMM Match : Ras (HMM E-Value=0) Length = 213 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/60 (40%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Frame = +1 Query: 82 DIPGLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSI-SAWMQEMN 258 D+ G K+ KLQLWDTAG+E++R ++ + ++R ++V+DV+ E+F SI W+ E + Sbjct: 53 DLDG-KKVKLQLWDTAGEEKYR-ALSRSFFRGADGALLVFDVSVKESFDSIRDYWLHEFH 110 Score = 31.9 bits (69), Expect = 0.49 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = +3 Query: 285 VLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTLAHKL 455 +LVGNKCD + +++ Q L+ Y + ETSA + NV F +A KL Sbjct: 120 ILVGNKCD--KKDKKVSEEDIQNLSSCYNLSWLETSA---KDNTNVNEAFEAMARKL 171 >SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/48 (45%), Positives = 32/48 (66%) Frame = +1 Query: 109 LQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQE 252 LQ+WDTAGQERF KS+ +YR ++VY V ++F ++S W +E Sbjct: 262 LQIWDTAGQERF-KSLRTPFYRGSDLCLLVYAVDDAKSFTNLSMWKKE 308 >SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) Length = 704 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/50 (42%), Positives = 32/50 (64%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWM 246 K+ KL + DTAGQER+ S++ Y+R V V +V+D+T TF + W+ Sbjct: 399 KKIKLTIGDTAGQERYF-SILPAYFRGVQGVFLVFDITVEITFLQLHRWI 447 >SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEMN 258 +LQ+W AGQERF SM + YY+ A V+++D+ + T W ++++ Sbjct: 69 RLQIWLIAGQERF-SSMTRVYYKGADACVVLFDLERQTTLDGAIKWKKDLD 118 >SB_11841| Best HMM Match : Ras (HMM E-Value=0) Length = 523 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/59 (42%), Positives = 33/59 (55%) Frame = +3 Query: 279 PRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTLAHKL 455 P VLVGNKCD P+ ++T+ AQ LA Y +P ETSA V+ F TL ++ Sbjct: 336 PMVLVGNKCD--LPQRTVSTSDAQELAKSYNIPFQETSA---KTRQGVDDAFYTLVREI 389 Score = 31.5 bits (68), Expect = 0.64 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +1 Query: 91 GLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 G + K + DTAGQE + +M Y R + V+ V ++F I+ + +++ Sbjct: 273 GKNKSKTDILDTAGQEEY-SAMRDQYMRTGEGFLCVFAVNNSKSFEDINQYREQI 326 >SB_54971| Best HMM Match : Ras (HMM E-Value=0) Length = 239 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 K +WDTAGQE+F + YY +I++DVT T+ ++ W +++ Sbjct: 82 KFNVWDTAGQEKF-GGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDL 130 >SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10) Length = 159 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/51 (31%), Positives = 30/51 (58%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQ 249 K+ K+ LWDT G E + +S+ +++Y N V++VY + P++ + Q Sbjct: 56 KKLKIHLWDTLGMEEY-ESLTRNHYSNSKVVLVVYSLDLPDSLAQVKECTQ 105 >SB_1071| Best HMM Match : Ras (HMM E-Value=0) Length = 228 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/53 (43%), Positives = 29/53 (54%) Frame = +3 Query: 264 GLMNAPRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNV 422 G N P VLVGNK D E ++ A+ LA+ +G P +ETSA S D V Sbjct: 89 GSENVPIVLVGNKSDI-YDEREVSVGEAKDLAEAWGCPFYETSAKTRSNVDKV 140 >SB_38511| Best HMM Match : Ras (HMM E-Value=1.2e-22) Length = 159 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 133 QERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 QER+R ++ YYR V+VYD+ K +F +++ W++E+ Sbjct: 2 QERYR-AITSAYYRGAMGAVLVYDIAKGTSFMNLNKWVEEL 41 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 133 QERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 QER+R ++ YYR V+VYD+ K +F +++ W++E+ Sbjct: 2 QERYR-AITSAYYRGAMGAVLVYDIAKGTSFMNLNKWVEEL 41 >SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) Length = 506 Score = 38.3 bits (85), Expect = 0.006 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 3/78 (3%) Frame = +1 Query: 31 NM*NLKYK*KM--SVNASQDIPGLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYD 204 N N KY+ + S++ + ++ G ++ +L LWDT+G E + + Y NV V+I +D Sbjct: 255 NQFNEKYEATVFNSLSTAVEVDG-ERIELTLWDTSGHEDY-DHVRPLSYNNVDIVLICFD 312 Query: 205 VTKPETFHSI-SAWMQEM 255 +++P+T SI W+ E+ Sbjct: 313 ISRPKTADSILEKWIIEV 330 >SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/59 (25%), Positives = 32/59 (54%) Frame = +1 Query: 79 QDIPGLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 + +PG K L+ WD G S +Y ++ +++V+D+T ++F ++ W+ E+ Sbjct: 52 EGMPGGKTFFLEFWDIGGSANHENSR-SIFYNGINGLILVHDLTNRKSFTNLRKWLAEV 109 >SB_1277| Best HMM Match : DAO (HMM E-Value=6e-32) Length = 523 Score = 37.1 bits (82), Expect = 0.013 Identities = 23/70 (32%), Positives = 38/70 (54%) Frame = +3 Query: 255 ESHGLMNAPRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIF 434 +++ NA +LVGNKCD E ++ ++LAD+ G+ +ETSA + NV+ +F Sbjct: 6 KTYSWANAQVILVGNKCDM-EEERVVSYDRGKQLADQLGLEFYETSA---KDNTNVKKVF 61 Query: 435 LTLAHKLYSK 464 L + K Sbjct: 62 ERLVDIICDK 71 >SB_58217| Best HMM Match : Ras (HMM E-Value=0.00048) Length = 472 Score = 35.9 bits (79), Expect = 0.030 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +1 Query: 109 LQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQ 249 + LWDT G E + +S+ +++Y N V++VY + P++ + Q Sbjct: 1 IHLWDTLGMEEY-ESLTRNHYSNSKVVLVVYSLDLPDSLAQVKECTQ 46 >SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) Length = 243 Score = 34.7 bits (76), Expect = 0.069 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 KLQ WD A ERF K M Y RN ++ + P S W +++ Sbjct: 109 KLQFWDVAEHERFLK-MTAVYCRNCSGALVFWGPKSPSRLSSALKWSEKV 157 >SB_2880| Best HMM Match : Ras (HMM E-Value=3.2e-17) Length = 134 Score = 34.7 bits (76), Expect = 0.069 Identities = 26/77 (33%), Positives = 36/77 (46%) Frame = +3 Query: 279 PRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTLAHKLY 458 P VLVGNK D + + T Q LA ++ P FETSA + V+ F L ++ Sbjct: 44 PIVLVGNKDDL-EGKREVTTQEGQELAHRFDCPFFETSA---CQRHFVDDAFHGLVREIR 99 Query: 459 SKQPLRVISVAGEVSKG 509 K+ R+ E KG Sbjct: 100 KKEKQRLTGHFQEEKKG 116 >SB_37276| Best HMM Match : Ras (HMM E-Value=0.00045) Length = 100 Score = 34.7 bits (76), Expect = 0.069 Identities = 20/42 (47%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +3 Query: 276 APRVLVGNKC--DCGTPESRLATTYAQRLADKYGMPLFETSA 395 A VLVGNKC DC E ++ + LA + G+P FETSA Sbjct: 9 AKAVLVGNKCHLDC---EREVSVAEGRGLAKELGLPFFETSA 47 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSI-SAWMQEM 255 KQ +L LWDTAGQE + + + Y + +++ + + P++ +I W E+ Sbjct: 5975 KQVELALWDTAGQEDYDR-LRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEV 6027 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 33.5 bits (73), Expect = 0.16 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +1 Query: 166 YYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 +Y++ ++VYDVT E+F ++ W+ E+ Sbjct: 10 FYKDTQGALLVYDVTSRESFEALDIWLDEI 39 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +1 Query: 109 LQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 L + DTAGQE F +M + Y R+ ++V+ VT +F I+ + ++ Sbjct: 61 LDILDTAGQEEF-SAMREQYMRSGEGFLLVFSVTDRSSFEEINKFYNQI 108 >SB_31439| Best HMM Match : Ras (HMM E-Value=4.7) Length = 55 Score = 33.5 bits (73), Expect = 0.16 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +1 Query: 166 YYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 +Y++ ++VYDVT E+F ++ W+ E+ Sbjct: 5 FYKDTQGALLVYDVTSRESFEALDIWLDEI 34 >SB_288| Best HMM Match : Ras (HMM E-Value=1.5e-11) Length = 220 Score = 33.5 bits (73), Expect = 0.16 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +1 Query: 97 KQKKLQLWDTAGQER----FRKSMVQHYYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 K L + DT G+ R +S V YR + VIV+DVT ++F + W+ ++ Sbjct: 15 KTVHLHIVDTPGESRSVFHLAESTVPLIYRALSGAVIVFDVTDRKSFERVPTWLDKV 71 Score = 31.5 bits (68), Expect = 0.64 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +3 Query: 279 PRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTL 443 P VLVGNK D ++ + A + A G ETSAL D + +I L L Sbjct: 80 PVVLVGNKTDRPLNSWKIPSNVAAKYATNNGFLYIETSALGMCNIDEIFAILLEL 134 >SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) Length = 1265 Score = 32.7 bits (71), Expect = 0.28 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 166 YYRNVHAVVIVYDVTKPETFHSISAWMQEM 255 YYR ++VYD+ K T+ ++ W++E+ Sbjct: 2 YYRGAVGALLVYDIAKHLTYENVERWLKEL 31 >SB_53183| Best HMM Match : Ras (HMM E-Value=0) Length = 834 Score = 32.3 bits (70), Expect = 0.37 Identities = 19/71 (26%), Positives = 36/71 (50%) Frame = +3 Query: 255 ESHGLMNAPRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIF 434 E H + ++++GNKCD ++ +++A ++G+ ETSA + N+E F Sbjct: 151 EEHANEDVEKMILGNKCDM-DDRRIVSRERGEQIAREHGIRFLETSAKTNI---NIEQAF 206 Query: 435 LTLAHKLYSKQ 467 LA + K+ Sbjct: 207 QYLAQDILKKE 217 Score = 30.3 bits (65), Expect = 1.5 Identities = 9/23 (39%), Positives = 19/23 (82%) Frame = +1 Query: 187 VVIVYDVTKPETFHSISAWMQEM 255 +++VYD+T+ +TF +IS W++ + Sbjct: 128 IMLVYDITQEKTFDNISKWLRNI 150 >SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) Length = 260 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 109 LQLWDTAGQERFRKSMVQHYYRNVHAVVIVYD 204 +++WD GQ RFR SM + Y R V+ +V + D Sbjct: 67 IKVWDIGGQPRFR-SMWERYCRGVNCIVYMVD 97 >SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 32.3 bits (70), Expect = 0.37 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSI-SAWMQEMN 258 K + LWDTAGQE + + + Y ++ +D+ +F +I S W+ E+N Sbjct: 51 KAYNVGLWDTAGQEDYDR-LRPLSYPMTDVFLVCFDIGSRTSFENIESKWLPELN 104 >SB_12958| Best HMM Match : Ras (HMM E-Value=6e-13) Length = 168 Score = 31.9 bits (69), Expect = 0.49 Identities = 23/56 (41%), Positives = 29/56 (51%) Frame = +3 Query: 279 PRVLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTLA 446 P VLVGNK D +A A+ A +YG +ETSAL + NV IF +A Sbjct: 72 PIVLVGNKRDLRRGRC-VAKDEAREFASEYGCSHYETSALTNR---NVHVIFYNMA 123 >SB_925| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=0.62) Length = 180 Score = 31.5 bits (68), Expect = 0.64 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = +3 Query: 207 YKARNVSFYISLDARDESHGLMNAPRVLVGNKCDCGTPESRLAT 338 Y A N+S YIS AR+ES V+VG K D P +R T Sbjct: 102 YAAINISAYISKKAREESKKKRKQMAVIVG-KIDFNLPRTRALT 144 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 31.1 bits (67), Expect = 0.85 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 166 YYRNVHAVVIVYDVTKPETFHSISAWMQEMN 258 YY+ IV+DVT+ TF ++ W +++ Sbjct: 710 YYKEAVGAFIVFDVTRASTFSAVQKWKNDLD 740 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 872 NVVDEYSRFPFVFTCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 924 >SB_57342| Best HMM Match : Arf (HMM E-Value=0) Length = 457 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/52 (23%), Positives = 24/52 (46%) Frame = +1 Query: 79 QDIPGLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETFHSI 234 + I K +WD GQ++ R+ + +HY++ ++ V D E + Sbjct: 146 ETISPCKNITFSVWDIGGQDKIRR-LWRHYFQGAEGIIFVVDSADKERIFEV 196 >SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +1 Query: 106 KLQLWDTAGQERFRKSMVQHYYR 174 +L LWDTAGQE F ++ + YYR Sbjct: 35 RLMLWDTAGQEEF-DAITKAYYR 56 >SB_31326| Best HMM Match : rve (HMM E-Value=6.1e-07) Length = 330 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 251 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSVFTMFGMPAYVHSDRGSSLISQEL 303 >SB_43575| Best HMM Match : Sina (HMM E-Value=0) Length = 432 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 121 DTAGQERFRKSMVQHYYRNVHAVVIVYDVTK 213 DTAG+E++ + Y R A ++ YD+TK Sbjct: 278 DTAGEEKYA-GLSSFYCRGASAAIVAYDITK 307 >SB_53279| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 337 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 156 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 208 >SB_49675| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 412 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 141 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 193 >SB_48115| Best HMM Match : rve (HMM E-Value=5.3e-36) Length = 238 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 57 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 109 >SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 998 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 919 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 971 >SB_30405| Best HMM Match : rve (HMM E-Value=5.1e-07) Length = 409 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 330 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 382 >SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1022 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 627 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 679 >SB_15390| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 748 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 474 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 526 >SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 1048 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 901 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 953 >SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 1020 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 1072 >SB_35114| Best HMM Match : RVT_1 (HMM E-Value=2.2e-11) Length = 512 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 429 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 481 >SB_9297| Best HMM Match : RVT_1 (HMM E-Value=7e-21) Length = 1032 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 535 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 587 >SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1677 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF++ C D + PT++ C +F+ +SDR + +S L Sbjct: 903 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFTMFGMPAYVHSDRGSSLISQEL 955 >SB_30773| Best HMM Match : rve (HMM E-Value=0.0063) Length = 336 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFSCIDN----YSDRNCNQLSSVL 522 N+ + S PF+ C D + T++ C +FS + +SDR + +SS L Sbjct: 265 NIMDEYSRFPFVLSCPDVSTSTVIKCLTSLFSLVGMPAYIHSDRGASFMSSEL 317 >SB_37042| Best HMM Match : Arf (HMM E-Value=0) Length = 188 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 97 KQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYD 204 K L +WD GQ++ R + +HY++ ++ V D Sbjct: 62 KNVTLTIWDVGGQDKIR-PLWRHYFQGTEGLLFVVD 96 >SB_9645| Best HMM Match : DUF101 (HMM E-Value=4.3) Length = 360 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFS 573 N+ + S PF++ C D + PT++ C +F+ Sbjct: 326 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFT 357 >SB_53792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.1 bits (62), Expect = 3.4 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +1 Query: 187 VVIVYDVTKPETFHSISAWMQEM 255 +++VYD+T ++F IS W+Q + Sbjct: 5 ILLVYDITTEDSFKHISQWLQNI 27 >SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) Length = 604 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/30 (33%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 169 YRNVHAVVIVYDVTKPETFHSIS-AWMQEM 255 YR+ +I +D+T P +F ++S W+ E+ Sbjct: 90 YRDTDVFIICFDITNPTSFQNVSTVWVPEL 119 >SB_42776| Best HMM Match : rve (HMM E-Value=1.4e-24) Length = 627 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 Query: 668 NLTENVSFDPFLYLCLDHNRPTILSCFNVIFS 573 N+ + S PF++ C D + PT++ C +F+ Sbjct: 391 NVVDEYSRFPFVFPCPDVSTPTVIKCLTSLFT 422 >SB_40202| Best HMM Match : Peptidase_M56 (HMM E-Value=4.4) Length = 180 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 169 YRNVHAVVIVYDVTKPETFHSISAWMQEMNPMV**MLLES 288 Y+ H V+++ D+TKP TF + + ++ P + ++L S Sbjct: 17 YKGTHGVLMLLDITKPWTFTYVRRELPKVPPHIPVLVLVS 56 >SB_29802| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 546 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 506 GVVTLSRQRKVGCSSDQNSCLC 571 G V L Q KVGC + SC+C Sbjct: 207 GTVVLPGQSKVGCFGAKQSCMC 228 >SB_25282| Best HMM Match : rve (HMM E-Value=6.3e-12) Length = 451 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = +1 Query: 79 QDIPGLKQKKLQLWDTAGQERFRKSMVQHYYRNVHAVVIVYDVTKPETF 225 QD +Q++ ++ D Q R R ++ + + + +I+Y+ T+P+ F Sbjct: 51 QDYGRYQQRRQKILDWQAQSRERGALAKQNFTDTGYALILYNQTRPKQF 99 >SB_22497| Best HMM Match : Ras (HMM E-Value=7.7e-07) Length = 769 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 169 YRNVHAVVIVYDVTKPETFHSISAWMQEMNPMV 267 Y+ H V+++ D+TKP TF + + ++ P + Sbjct: 278 YKGTHGVLMLLDITKPWTFTYVRRELPKVPPHI 310 >SB_44983| Best HMM Match : Death (HMM E-Value=4.8e-09) Length = 868 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = -2 Query: 604 RYFHVSMLFSVA*TTILIGTATNFPLS*QCDHPLLTSPATLITLNGCLE 458 R +H+S T +I N LS QCD P L + A + + CLE Sbjct: 710 RIYHLSSRNKARAVTCVIFLGANIVLSCQCDEPALCARA-YVRSSKCLE 757 >SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) Length = 263 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = +3 Query: 285 VLVGNKCDCGTPESRLATTYAQRLADKYGMPLFETSALLDSECDNVESIFLTLAHKLYSK 464 +++GNK D E + QRLA+ YG E SAL E + ++ L + +K Sbjct: 143 LVIGNKSDL-IGERDVTRDEGQRLAETYGWLFAEASAL---EYEAADACIADLVRDMMAK 198 Query: 465 QPLR 476 + +R Sbjct: 199 RSMR 202 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,755,856 Number of Sequences: 59808 Number of extensions: 414959 Number of successful extensions: 1061 Number of sequences better than 10.0: 80 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1028 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -