BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40301 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) 114 8e-26 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 101 6e-22 SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) 97 1e-20 SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 78 6e-15 SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26) 33 0.18 SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) 32 0.40 SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) 31 1.2 SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) 30 1.6 SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) 30 2.2 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_21189| Best HMM Match : PCI (HMM E-Value=8.2) 29 5.0 SB_37907| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_15627| Best HMM Match : AMPKBI (HMM E-Value=3e-36) 28 6.6 SB_13701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_25339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) Length = 123 Score = 114 bits (274), Expect = 8e-26 Identities = 53/95 (55%), Positives = 69/95 (72%), Gaps = 2/95 (2%) Frame = +3 Query: 255 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 434 +D+ L +F+T +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG GQ Sbjct: 1 MDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQ 60 Query: 435 TREHALLAFTLGVKQLIVGVNKMDS--LNHHTVSP 533 TREHA+L +LGV QLIV +NK+D L +H P Sbjct: 61 TREHAILVRSLGVTQLIVAINKLDMVVLGYHRGKP 95 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 101 bits (242), Expect = 6e-22 Identities = 43/84 (51%), Positives = 61/84 (72%) Frame = +3 Query: 255 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 434 +++ F+T + T++DAPGH+ F+ NMI+G +QAD VL+++A GEFE G + GQ Sbjct: 210 VEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGFERGGQ 269 Query: 435 TREHALLAFTLGVKQLIVGVNKMD 506 TREHA+LA T GVK L++ VNKMD Sbjct: 270 TREHAMLAKTAGVKHLVILVNKMD 293 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/40 (45%), Positives = 28/40 (70%) Frame = +2 Query: 125 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERD 244 Y G +DKRT+EK+E+EA+E + ++ +W LD + ERD Sbjct: 166 YLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERD 205 Score = 33.9 bits (74), Expect = 0.13 Identities = 11/24 (45%), Positives = 21/24 (87%) Frame = +2 Query: 521 YSEPRFEEIKKEVSSYIKKIGYNP 592 ++E R+EEIK +++ ++KK+G+NP Sbjct: 299 WNEERYEEIKVKLTPFLKKVGFNP 322 >SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) Length = 106 Score = 97.1 bits (231), Expect = 1e-20 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +2 Query: 41 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM 187 M KEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE+ E+ Sbjct: 1 MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEV 49 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 255 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 362 IDIALWKFET KYYVT+IDAPGHRDFIKNMITGTSQ Sbjct: 25 IDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 185 MGKGSFKYAWVLDKLKAERD 244 MGKGSFKYAWVLDKLKAER+ Sbjct: 1 MGKGSFKYAWVLDKLKAERE 20 Score = 31.5 bits (68), Expect = 0.71 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 635 NMLEPSTKMPWFKGWQVER 691 NM+ +++MPWFK W +ER Sbjct: 53 NMITGTSQMPWFKQWTIER 71 >SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 35.1 bits (77), Expect = 0.057 Identities = 28/85 (32%), Positives = 40/85 (47%) Frame = +3 Query: 252 HIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNG 431 HI L K + + +T ID PGH F G + D VL+VAA G ++ Sbjct: 64 HIGAFLVKLPSGEK-ITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDGV----KTQTV 118 Query: 432 QTREHALLAFTLGVKQLIVGVNKMD 506 ++ HA+ A LIV +NK+D Sbjct: 119 ESIRHAMHAKV----PLIVAINKID 139 >SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26) Length = 541 Score = 33.5 bits (73), Expect = 0.18 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = +3 Query: 306 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 485 +D PGH + M+ G + D A+L++A QT EH + +K ++ Sbjct: 69 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 122 Query: 486 VGVNKMD 506 + NK+D Sbjct: 123 ILQNKID 129 >SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 833 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +2 Query: 41 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 136 M K+ N+ VI HVD GKST T L+ K G Sbjct: 12 MDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAG 43 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 291 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 401 + + +ID+PGH DF + D A+++V +G Sbjct: 99 FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 135 >SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) Length = 240 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/85 (25%), Positives = 33/85 (38%) Frame = +3 Query: 261 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 440 I + + + +D PGH F G D +++VAA QT+ Sbjct: 128 IGAYSVKVGDQKIAFLDTPGHEAFTAMRARGAQVTDLVIIVVAADDDVMP-------QTK 180 Query: 441 EHALLAFTLGVKQLIVGVNKMDSLN 515 E A GV +I +NK+D N Sbjct: 181 EAISHAQAAGV-PIIFAINKIDKPN 204 >SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) Length = 783 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +3 Query: 234 LSVTRYHIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 386 L+ R + +F+ + IID PGH F G+S D A+L+V Sbjct: 659 LNAIRIQTKMVKEEFDIKIPGLLIIDTPGHESFSNLRSRGSSLCDMAILVV 709 >SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 359 Score = 29.9 bits (64), Expect = 2.2 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 297 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 401 + I+D PGH+DF ++ + D ++++ G Sbjct: 81 INILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKG 115 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 56 THINIVVIGHVDSGKSTTTGHLIY 127 T I + V+G+V+SGKST G L Y Sbjct: 111 TDIRMAVLGNVESGKSTLLGVLTY 134 >SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 461 HPRCQTAHRRSKQNGFTEPPYSEPRFEEIKKEVSSYIKKIGYN 589 H + + RR ++N + + P+FE++K + +S KKI N Sbjct: 109 HETTEPSVRRCQRNSVRDIDAAWPKFEKLKSQFNSNSKKISMN 151 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 65 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 163 N ++ HVD GKST L+ G I K + K Sbjct: 1943 NFSIVAHVDHGKSTLADRLLEVTGTISKSSDNK 1975 >SB_21189| Best HMM Match : PCI (HMM E-Value=8.2) Length = 125 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 5/58 (8%) Frame = +2 Query: 431 SNP*ACLARFHPRC-----QTAHRRSKQNGFTEPPYSEPRFEEIKKEVSSYIKKIGYN 589 +N A L RF C ++A RR ++N + + P+F+ +K + S KKI N Sbjct: 25 NNEFAALKRFLKNCMHETTESAVRRCQRNSVMDIDAAWPKFQRLKSQFSINSKKISMN 82 >SB_37907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 461 HPRCQTAHRRSKQNGFTEPPYSEPRFEEIKKEVSSYIKKIGYN 589 H ++A RR ++N + + P+F+ +K + S KKI N Sbjct: 8 HETTESAVRRCQRNSVMDIDAAWPKFQRLKSQFSINSKKISMN 50 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 28.3 bits (60), Expect = 6.6 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +3 Query: 471 VKQLIVGVNKMDSLNHHTVSPDLRKSRRKY--PHTSRRLATTQLLSLSCPFLDGTETTCW 644 V Q+ G+N + S T+SP+ R RK P+ R++ T+L ++ P+L T W Sbjct: 229 VHQMSRGLNAIHSKYMATLSPECRDVLRKLLEPNPQLRISLTEL--MAHPWL--TSKGTW 284 Query: 645 SLQP 656 L+P Sbjct: 285 PLEP 288 >SB_15627| Best HMM Match : AMPKBI (HMM E-Value=3e-36) Length = 255 Score = 28.3 bits (60), Expect = 6.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 377 HSAISLRGSCDHVLDEISVSR--SINDGNIVLASFELPESNIDVIPSHAQPLV 225 ++ IS+R + V D + SIN G+I S P + +IPSH P++ Sbjct: 123 NNVISVRKTDMDVFDALDTDANLSINSGSIKSVSGSPPGTYGQIIPSHVTPVI 175 >SB_13701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.3 bits (60), Expect = 6.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 623 WHGDNMLEPSTKMPWFKGWQVERKE 697 +H DN + PWF+ W +++E Sbjct: 191 YHNDNKTHSTQTGPWFRAWSNQKRE 215 >SB_25339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/61 (22%), Positives = 31/61 (50%) Frame = +3 Query: 348 TGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTV 527 TGT+ D + + G+F++ ++ N + LLA +G+ + G+ +++ HT Sbjct: 790 TGTNVLDSIISLTPGKIGQFDSSVTMNEDSTSE-LLASIMGLTKTTSGLLVSQTVSTHTT 848 Query: 528 S 530 + Sbjct: 849 A 849 >SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 679 PSLEPRHFG*RLQHVVSVPSRNGHESDSSWVVANLLD 569 P+LEP + G L + S S GH+ D+ ++ LL+ Sbjct: 378 PNLEPSYIGKMLATIESTLSAKGHQEDAEEFLSCLLN 414 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,879,390 Number of Sequences: 59808 Number of extensions: 489100 Number of successful extensions: 1524 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1523 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -