BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40298 (724 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 1.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.9 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 3.3 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 3.3 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 4.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.8 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 276 KIFILSIRFVFPSLLDIPV 220 K+ I S+ F FP L +PV Sbjct: 154 KVMIQSVSFAFPINLSVPV 172 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 276 KIFILSIRFVFPSLLDIPV 220 K+ I S+ F FP L +PV Sbjct: 387 KVMIQSVSFAFPINLSVPV 405 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 276 KIFILSIRFVFPSLLDIPV 220 K+ I S+ F FP L +PV Sbjct: 387 KVMIQSVSFAFPINLSVPV 405 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 93 MVSATHAHGHQH 58 +VSA H H HQH Sbjct: 18 VVSAEHPHQHQH 29 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 93 MVSATHAHGHQH 58 +VSA H H HQH Sbjct: 18 VVSAEHPHQHQH 29 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = -2 Query: 585 YSRHSCATSRRRHDMRTLLSWPLETTTRSCRS 490 Y+ +C +D + SWP E + C S Sbjct: 133 YNMITCPNGLVYNDKAGICSWPDEAKKKGCSS 164 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/34 (29%), Positives = 13/34 (38%) Frame = -2 Query: 570 CATSRRRHDMRTLLSWPLETTTRSCRSNGKPSTS 469 CA + R + WP + KPSTS Sbjct: 1131 CAGGLHWNKERKICDWPKSAKCEEKKPGHKPSTS 1164 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,965 Number of Sequences: 336 Number of extensions: 3129 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -