BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40298 (724 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_15464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_16381| Best HMM Match : DUF1222 (HMM E-Value=9.6e-06) 28 8.8 >SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1845 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +2 Query: 503 RVVVSSGHDKRVLMSCRLREVAHECRL 583 RV+V SG ++VL R RE HEC L Sbjct: 117 RVLVMSGKKRQVLDGDRGRECVHECSL 143 >SB_15464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 112 VPYRLLDGECHTCSWTSALLLLFIYMLTII 23 VP++L++ + T W S L LFIY++ ++ Sbjct: 637 VPFKLMNLKWQTFGWLSLWLNLFIYLMYLM 666 >SB_16381| Best HMM Match : DUF1222 (HMM E-Value=9.6e-06) Length = 156 Score = 27.9 bits (59), Expect = 8.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 371 LFFSWIVYKSVFVNFFKLLFINGCFSIL 288 +FF ++ + NFF LL + CFSIL Sbjct: 51 IFFQLLIILTGNYNFFNLLAVLACFSIL 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,779,860 Number of Sequences: 59808 Number of extensions: 373722 Number of successful extensions: 955 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -