BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40298 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 4.1 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 23 7.2 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 24.2 bits (50), Expect = 4.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 550 ARHENPLVVAAGNYYPI 500 AR + P+V+ GN YP+ Sbjct: 338 ARAQRPMVIKVGNVYPM 354 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 23.4 bits (48), Expect = 7.2 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 6/68 (8%) Frame = -1 Query: 718 QYFFNPMTAMWVQSRFCR-----IAVGAPW-FLRNVDLHDDLELDPVSKYLQSAFVRHFA 557 Q F + A W++SR C+ +A G P+ L V + +D + L+ + R + Sbjct: 172 QMFMHCPRATWIESRSCQTMRELLATGCPYKTLGEVVVLNDEGYVRDDRILEEEYDRPYR 231 Query: 556 KTARHENP 533 R E+P Sbjct: 232 GRGRTESP 239 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,110 Number of Sequences: 2352 Number of extensions: 12129 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -