BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40294 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 28 0.36 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 3.3 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 3.3 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 24 4.4 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 7.7 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 23 7.7 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 27.9 bits (59), Expect = 0.36 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 16 WFEIKKK*CLHSKTAGFNNSGISELVLFHR 105 W E++K+ HSK G + ++E VLFH+ Sbjct: 244 WKEMRKRIDHHSKVYGTMYAKVTECVLFHK 273 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +2 Query: 545 IHRKHTKMLLKSARRK-CSPH 604 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +2 Query: 545 IHRKHTKMLLKSARRK-CSPH 604 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.2 bits (50), Expect = 4.4 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +2 Query: 290 WRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKV 463 W+V+ ++ + K + + +V K C V L+D LI K NP+ V Sbjct: 274 WKVMKDVKDFIKLLLHKAFIVENQPPQVMKMNTRFCASVRLLIDNALIMKIGNPKVTV 331 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 670 LANLISHNKRLRNLTPDPALWGVWA 596 LAN + N+ R T + ++GVWA Sbjct: 16 LANEFNPNRGRRRPTKNQQIYGVWA 40 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 103 RPRCPSTRKNWCNVP 147 RPR PS R N N+P Sbjct: 126 RPRTPSMRVNCTNIP 140 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 797,602 Number of Sequences: 2352 Number of extensions: 16448 Number of successful extensions: 86 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -