BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdV40289
(703 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_UPI00006CFBE1 Cluster: Zinc carboxypeptidase family pro... 33 6.8
>UniRef50_UPI00006CFBE1 Cluster: Zinc carboxypeptidase family
protein; n=1; Tetrahymena thermophila SB210|Rep: Zinc
carboxypeptidase family protein - Tetrahymena
thermophila SB210
Length = 1251
Score = 33.1 bits (72), Expect = 6.8
Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 4/71 (5%)
Frame = -1
Query: 406 INRSSYDLFSENV----VLFVFSIINSSRHLLANNNTIFLIEGN*PL*RRNKMAFQKKKK 239
IN+ ++ + +N+ V F+F S+H+ + + I+ P+ R N+ + KKKK
Sbjct: 607 INKQNFQIQQQNINNDQVSFIFLGNQQSQHISNSEKKFYKIDEEDPIVRPNQNSLSKKKK 666
Query: 238 RTKLGHHLVNI 206
R +L I
Sbjct: 667 RKNYEQYLSEI 677
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 591,432,552
Number of Sequences: 1657284
Number of extensions: 11403232
Number of successful extensions: 23650
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 22705
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23642
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55785129165
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -