Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40289
         (703 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00006CFBE1 Cluster: Zinc carboxypeptidase family pro...    33   6.8  

>UniRef50_UPI00006CFBE1 Cluster: Zinc carboxypeptidase family
           protein; n=1; Tetrahymena thermophila SB210|Rep: Zinc
           carboxypeptidase family protein - Tetrahymena
           thermophila SB210
          Length = 1251

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 4/71 (5%)
 Frame = -1

Query: 406 INRSSYDLFSENV----VLFVFSIINSSRHLLANNNTIFLIEGN*PL*RRNKMAFQKKKK 239
           IN+ ++ +  +N+    V F+F     S+H+  +    + I+   P+ R N+ +  KKKK
Sbjct: 607 INKQNFQIQQQNINNDQVSFIFLGNQQSQHISNSEKKFYKIDEEDPIVRPNQNSLSKKKK 666

Query: 238 RTKLGHHLVNI 206
           R     +L  I
Sbjct: 667 RKNYEQYLSEI 677


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 591,432,552
Number of Sequences: 1657284
Number of extensions: 11403232
Number of successful extensions: 23650
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 22705
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23642
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55785129165
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)