BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40287 (282 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22901| Best HMM Match : PHD (HMM E-Value=5.3e-05) 42 6e-05 SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) 42 6e-05 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-05 SB_55616| Best HMM Match : Exo_endo_phos (HMM E-Value=0.032) 42 8e-05 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 42 1e-04 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) 41 1e-04 SB_15614| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 1e-04 SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) 40 2e-04 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 3e-04 SB_12693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0014) 40 3e-04 SB_8966| Best HMM Match : SAP (HMM E-Value=1.6e-08) 40 4e-04 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 39 5e-04 SB_9001| Best HMM Match : PHD (HMM E-Value=0.00096) 38 0.001 SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05) 37 0.003 SB_5695| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.003 SB_59041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.005 SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.005 SB_28392| Best HMM Match : Exo_endo_phos (HMM E-Value=0.77) 36 0.005 SB_20258| Best HMM Match : Exo_endo_phos (HMM E-Value=7.1e-16) 36 0.005 SB_48818| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00029) 36 0.005 SB_42532| Best HMM Match : Exo_endo_phos (HMM E-Value=7.2e-16) 36 0.005 SB_5021| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.007 SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) 36 0.007 SB_58594| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.009 SB_52896| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0023) 35 0.009 SB_32724| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0029) 35 0.009 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.009 SB_21551| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0016) 35 0.009 SB_16136| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0025) 35 0.009 SB_58716| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.009 SB_40429| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0036) 35 0.009 SB_39138| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.009 SB_24349| Best HMM Match : Exo_endo_phos (HMM E-Value=0.001) 35 0.009 SB_9753| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.009 SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 34 0.015 SB_30214| Best HMM Match : Exo_endo_phos (HMM E-Value=6.1e-11) 33 0.027 SB_6629| Best HMM Match : Lipase_GDSL (HMM E-Value=2.2) 33 0.027 SB_17390| Best HMM Match : Exo_endo_phos (HMM E-Value=3.1e-13) 33 0.035 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.035 SB_1162| Best HMM Match : Exo_endo_phos (HMM E-Value=5.3e-08) 33 0.035 SB_51484| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0036) 33 0.035 SB_46645| Best HMM Match : Exo_endo_phos (HMM E-Value=0.044) 33 0.035 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.035 SB_4374| Best HMM Match : GCS (HMM E-Value=6.2) 33 0.035 SB_4717| Best HMM Match : Exo_endo_phos (HMM E-Value=0.49) 33 0.047 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.047 SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) 32 0.062 SB_44712| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.082 SB_30872| Best HMM Match : KID (HMM E-Value=4.7) 32 0.082 SB_53389| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10) 31 0.11 SB_25449| Best HMM Match : Exo_endo_phos (HMM E-Value=7.4e-07) 31 0.11 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.11 SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 31 0.11 SB_32355| Best HMM Match : Laminin_EGF (HMM E-Value=0) 31 0.11 SB_31839| Best HMM Match : Exo_endo_phos (HMM E-Value=1.3e-11) 31 0.11 SB_7296| Best HMM Match : PHD (HMM E-Value=0.0013) 31 0.14 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 31 0.14 SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.19 SB_2748| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7e-08) 31 0.19 SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.19 SB_3879| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.19 SB_27477| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.25 SB_34002| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.33 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 30 0.33 SB_17643| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00047) 30 0.33 SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 29 0.44 SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.44 SB_2904| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.44 SB_50943| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_45939| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00051) 29 0.76 SB_39504| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00014) 29 0.76 SB_3206| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00047) 29 0.76 SB_1792| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7e-11) 29 0.76 SB_1356| Best HMM Match : GCV_T (HMM E-Value=5.1e-40) 29 0.76 SB_84| Best HMM Match : PHD (HMM E-Value=0.0019) 29 0.76 SB_52105| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0012) 29 0.76 SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) 29 0.76 SB_23583| Best HMM Match : TSP_1 (HMM E-Value=0.095) 28 1.0 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 28 1.3 SB_56875| Best HMM Match : LON (HMM E-Value=0) 27 1.8 SB_53562| Best HMM Match : Exo_endo_phos (HMM E-Value=0.018) 27 1.8 SB_50541| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_41990| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) 27 1.8 SB_33668| Best HMM Match : DUF1590 (HMM E-Value=9.5) 27 1.8 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_26795| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10) 27 2.3 SB_46140| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_15382| Best HMM Match : Exo_endo_phos (HMM E-Value=2.2e-06) 27 3.1 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 27 3.1 SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) 27 3.1 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_14881| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_6377| Best HMM Match : Exo_endo_phos (HMM E-Value=6.5e-10) 27 3.1 SB_2883| Best HMM Match : Exo_endo_phos (HMM E-Value=2.1e-09) 27 3.1 SB_19882| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) 26 4.1 SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.4 SB_58916| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_27034| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_11891| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-35) 25 7.1 SB_59443| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) 25 9.4 SB_57416| Best HMM Match : rve (HMM E-Value=0.0011) 25 9.4 SB_57121| Best HMM Match : FCD (HMM E-Value=9.4) 25 9.4 SB_54562| Best HMM Match : RVT_1 (HMM E-Value=1.4e-06) 25 9.4 SB_52359| Best HMM Match : FCD (HMM E-Value=7.8) 25 9.4 SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) 25 9.4 SB_36517| Best HMM Match : RVT_1 (HMM E-Value=1.4e-06) 25 9.4 SB_22667| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) 25 9.4 SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) 25 9.4 SB_20587| Best HMM Match : rve (HMM E-Value=7.2e-15) 25 9.4 SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11) 25 9.4 SB_9289| Best HMM Match : EGF_2 (HMM E-Value=6.1) 25 9.4 SB_4623| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) 25 9.4 SB_57312| Best HMM Match : RVT_1 (HMM E-Value=0.0069) 25 9.4 SB_35469| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.4 SB_34271| Best HMM Match : RVT_1 (HMM E-Value=3.4e-07) 25 9.4 SB_33139| Best HMM Match : EGF_2 (HMM E-Value=6.1) 25 9.4 SB_24375| Best HMM Match : rve (HMM E-Value=7.2e-15) 25 9.4 SB_4973| Best HMM Match : RVT_1 (HMM E-Value=8.6e-11) 25 9.4 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.4 >SB_22901| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 696 Score = 42.3 bits (95), Expect = 6e-05 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 5/93 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR DGYGGV L +++ S + L S + Sbjct: 238 VIGTETWLNPSVKTCEFFPSNYSVFRKDRPDGYGGVLLAVKDLSCHELYELNSDCETVWI 297 Query: 94 IAAI--VDGICFVSIYVPHPSLQIFNEIKNLIS 2 +I + + Y P S + +E+ +S Sbjct: 298 KVSINRTKHVYIGAFYNPDSSCEALDELDRSLS 330 >SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 822 Score = 42.3 bits (95), Expect = 6e-05 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 5/93 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR DGYGGV L +++ S + L S + Sbjct: 238 VIGTETWLNPSVKTCEFFPSNYSVFRKDRPDGYGGVLLAVKDLSCHELYELNSDCETVWI 297 Query: 94 IAAI--VDGICFVSIYVPHPSLQIFNEIKNLIS 2 +I + + Y P S + +E+ +S Sbjct: 298 KVSINRTKHVYIGAFYNPDSSCEALDELDRSLS 330 >SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 913 Score = 42.3 bits (95), Expect = 6e-05 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 5/93 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR DGYGGV L +++ S + L S + Sbjct: 217 VIGTETWLNPSVKTCEFFPSNYSVFRKDRPDGYGGVLLAVKDLSCHELYELNSDCETVWI 276 Query: 94 IAAI--VDGICFVSIYVPHPSLQIFNEIKNLIS 2 +I + + Y P S + +E+ +S Sbjct: 277 KVSINRTKHVYIGAFYNPDSSCEALDELDRSLS 309 >SB_55616| Best HMM Match : Exo_endo_phos (HMM E-Value=0.032) Length = 296 Score = 41.9 bits (94), Expect = 8e-05 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 3/60 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR+DGYGGV L +++ S + L +S+C +V Sbjct: 113 VIGTETWLNPSVKTCEFFPSNYSVFRKDRSDGYGGVLLAVKDLSCHELYEL--NSDCETV 170 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 41.5 bits (93), Expect = 1e-04 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR DGYGGV L +++ S + L +S+C +V Sbjct: 220 VIGTETWLNPSVKTCEFFPSNYSVFRKDRTDGYGGVLLAVKDLSCHELYEL--NSDCETV 277 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 41.5 bits (93), Expect = 1e-04 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR DGYGGV L +++ S + L +S+C +V Sbjct: 1385 VIGTETWLNPSVXTCEFFPSNYSVFRKDRPDGYGGVLLAVKDLSCHELYEL--NSDCETV 1442 >SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 790 Score = 41.1 bits (92), Expect = 1e-04 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR DGYGGV L +++ S + L +S+C +V Sbjct: 234 VIGTETWLNPSVKTCEFFPSNYSVFRKDRPDGYGGVLLAVKDLSCHELYEL--NSDCETV 291 >SB_15614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 223 Score = 41.1 bits (92), Expect = 1e-04 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR DGYGGV L +++ S + L +S+C +V Sbjct: 116 VIGTETWLNPSVKTCEFFPSNYSVFRKDRPDGYGGVLLAVKDLSCHELYEL--NSDCETV 173 >SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) Length = 993 Score = 40.3 bits (90), Expect = 2e-04 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 3/76 (3%) Frame = -3 Query: 223 KIPGYSCLREDRADGYGGVCLLIRNSSTF---SSFPLPSHSNCFSVIAAIVDGICFVSIY 53 +IPGY +R+DR GGVCL +R+S + + P + C + IY Sbjct: 508 RIPGYDIIRKDRNRNGGGVCLYLRSSINYCIRNLVPDSVEAVCVEITKPHSRPFFVSIIY 567 Query: 52 VPHPSLQIFNEIKNLI 5 P + FN+++ LI Sbjct: 568 RPESPIDYFNDLEQLI 583 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 39.9 bits (89), Expect = 3e-04 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 4/77 (5%) Frame = -3 Query: 223 KIPGYSCLREDRADGYGGVCLLIRNSSTF----SSFPLPSHSNCFSVIAAIVDGICFVSI 56 +IPGY +R+DR GGVCL +R+S + P + C + I Sbjct: 244 RIPGYDIIRKDRNRNVGGVCLYLRSSINYCIRNDLVPDSVEAVCVEITKPHSRPFFVSII 303 Query: 55 YVPHPSLQIFNEIKNLI 5 Y P + FN+++ LI Sbjct: 304 YRPESPIDYFNDLEQLI 320 >SB_12693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0014) Length = 413 Score = 39.9 bits (89), Expect = 3e-04 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR DGYGGV L ++ S + L +S+C +V Sbjct: 154 VIGTETWLNPSVKTCEFFPSNYSVFRKDRPDGYGGVLLAFKDLSCHELYKL--NSDCETV 211 >SB_8966| Best HMM Match : SAP (HMM E-Value=1.6e-08) Length = 696 Score = 39.5 bits (88), Expect = 4e-04 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 4/77 (5%) Frame = -3 Query: 223 KIPGYSCLREDRADGYGGVCLLIRNSSTF----SSFPLPSHSNCFSVIAAIVDGICFVSI 56 +IPGY +R+DR GGVCL +R+S + P + C + I Sbjct: 475 RIPGYDIIRKDRNRNGGGVCLYLRSSINYCIRNDRVPDSVEAVCVEITKPHSRPFFVSII 534 Query: 55 YVPHPSLQIFNEIKNLI 5 Y P + FN+++ LI Sbjct: 535 YRPESPIDYFNDLEQLI 551 >SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) Length = 1061 Score = 39.1 bits (87), Expect = 5e-04 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+DR +GYGGV L +++ S + L +S+C +V Sbjct: 306 VIGTETWLNPSVKTCEFFPSNYSVFRKDRPNGYGGVLLAVKDLSCHELYEL--NSDCETV 363 >SB_9001| Best HMM Match : PHD (HMM E-Value=0.00096) Length = 345 Score = 38.3 bits (85), Expect = 0.001 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = -3 Query: 265 IFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 + ETWL P F YS R+ R DGYGGV L +++ S + L +S+C +V Sbjct: 238 VIGTETWLNPSVKTCEFFPSNYSVFRKGRPDGYGGVLLAVKDLSCHELYEL--NSDCETV 295 >SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05) Length = 670 Score = 36.7 bits (81), Expect = 0.003 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = -3 Query: 223 KIPGYSCLREDRADGYGGVCLLIRNSSTF---SSFPLPSHSNCFSVIAAIVDGICFVSIY 53 +I GY +R+DR GGVCL +R+S + + P + C + IY Sbjct: 389 RIRGYDIIRKDRNRNGGGVCLYLRSSINYCIRNLVPDSVEAVCVEITKPHSRPFFVSIIY 448 Query: 52 VPHPSLQIFNEIKNLI 5 P + FN+++ LI Sbjct: 449 RPESPIDYFNDLEQLI 464 >SB_5695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 36.7 bits (81), Expect = 0.003 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -3 Query: 274 SFYIFSIETWLKP---DFVFKIPGYSCLREDRADG-YGGVCLLIRNSSTF 137 S ++ ETWLK D V I G++ +R DR +GGVCL I+ S F Sbjct: 209 SDFVCITETWLKEHIDDNVIAISGFNVVRRDRITAQHGGVCLYIKESIKF 258 >SB_59041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 35.9 bits (79), Expect = 0.005 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = -3 Query: 253 ETWLKP---DFVFKIPGYSCLREDRA---DGYGGVCLLIRNSSTF 137 ETWL D +PG+ C R DR+ +GYGGV +R+ F Sbjct: 185 ETWLDSQTADAEINLPGFVCARRDRSGTKEGYGGVATFVRDDLAF 229 >SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2362 Score = 35.9 bits (79), Expect = 0.005 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = -3 Query: 253 ETWLKP---DFVFKIPGYSCLREDRA---DGYGGVCLLIRNSSTF 137 ETWL D +PG+ C R DR+ +GYGGV +R+ F Sbjct: 1674 ETWLDSQTADAEINLPGFVCARRDRSGTKEGYGGVATFVRDDLAF 1718 >SB_28392| Best HMM Match : Exo_endo_phos (HMM E-Value=0.77) Length = 549 Score = 35.9 bits (79), Expect = 0.005 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLK---PDFVFKIPGYSCLREDRADGY-GGVCLLI 155 ETWL PD + Y CLR+DRA G GGVC+ I Sbjct: 151 ETWLNSSIPDSAIALHNYVCLRKDRAVGQCGGVCVYI 187 >SB_20258| Best HMM Match : Exo_endo_phos (HMM E-Value=7.1e-16) Length = 525 Score = 35.9 bits (79), Expect = 0.005 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = -3 Query: 253 ETWLKP---DFVFKIPGYSCLREDRA---DGYGGVCLLIRNSSTF 137 ETWL D +PG+ C R DR+ +GYGGV +R+ F Sbjct: 74 ETWLDSQTADAEINLPGFVCARRDRSGTKEGYGGVATFVRDDLAF 118 >SB_48818| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00029) Length = 318 Score = 35.9 bits (79), Expect = 0.005 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = -3 Query: 253 ETWLKP---DFVFKIPGYSCLREDRA---DGYGGVCLLIRNSSTF 137 ETWL D +PG+ C R DR+ +GYGGV +R+ F Sbjct: 14 ETWLDSQTADAEINLPGFVCARRDRSGTKEGYGGVATFVRDDLAF 58 >SB_42532| Best HMM Match : Exo_endo_phos (HMM E-Value=7.2e-16) Length = 399 Score = 35.9 bits (79), Expect = 0.005 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = -3 Query: 253 ETWLKP---DFVFKIPGYSCLREDRA---DGYGGVCLLIRNSSTF 137 ETWL D +PG+ C R DR+ +GYGGV +R+ F Sbjct: 74 ETWLDSQTADAEINLPGFVCARRDRSGTKEGYGGVATFVRDDLAF 118 >SB_5021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 35.5 bits (78), Expect = 0.007 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 6/78 (7%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTF----SSFPLPSHSNCFSVIAAIVDGICFVSIY 53 IPG+ +R+DR GGVCL +R+S + P + C +I ++Y Sbjct: 206 IPGFDIIRKDRKRNGGGVCLYVRDSHNYRIRNDLVPEDLEAVCVEIIKPNSKPFIVCTVY 265 Query: 52 VPH--PSLQIFNEIKNLI 5 P S + F +NLI Sbjct: 266 RPFIISSREFFVSFENLI 283 >SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) Length = 508 Score = 35.5 bits (78), Expect = 0.007 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Frame = -3 Query: 253 ETWLK---PDFVFKIPGYSCLREDRADGY-GGVCLLIRN 149 ETWL PD + +PGY C R DR GGVC I + Sbjct: 132 ETWLNESHPDPLIHLPGYLCFRNDRTTSRGGGVCTYINS 170 >SB_58594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1001 Score = 35.1 bits (77), Expect = 0.009 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLI 155 E+WL PD +PG+SC R DR GGVC+ + Sbjct: 777 ESWLHPDIPDAAVNLPGFSCFRRDRTHTSGGGVCVYV 813 >SB_52896| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0023) Length = 393 Score = 35.1 bits (77), Expect = 0.009 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLI 155 E+WL PD +PG+SC R DR GGVC+ + Sbjct: 79 ESWLHPDIPDAAVNLPGFSCFRRDRTHTSGGGVCVYV 115 >SB_32724| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0029) Length = 302 Score = 35.1 bits (77), Expect = 0.009 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLI 155 E+WL PD +PG+SC R DR GGVC+ + Sbjct: 45 ESWLHPDIPDAAVNLPGFSCFRRDRTHTSGGGVCVYV 81 >SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 816 Score = 35.1 bits (77), Expect = 0.009 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLI 155 E+WL PD +PG+SC R DR GGVC+ + Sbjct: 154 ESWLHPDIPDAAVNLPGFSCFRRDRTHTSGGGVCVYV 190 >SB_21551| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0016) Length = 999 Score = 35.1 bits (77), Expect = 0.009 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLI 155 E+WL PD +PG+SC R DR GGVC+ + Sbjct: 358 ESWLHPDIPDAAVNLPGFSCFRRDRTHTSGGGVCVYV 394 >SB_16136| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0025) Length = 731 Score = 35.1 bits (77), Expect = 0.009 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLI 155 E+WL PD +PG+SC R DR GGVC+ + Sbjct: 428 ESWLHPDIPDAAVNLPGFSCFRRDRTHTSGGGVCVYV 464 >SB_58716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 35.1 bits (77), Expect = 0.009 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 4/40 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLIRNS 146 ETWL+ V + GY+ +R DR D +GGVC+ I++S Sbjct: 119 ETWLRNHIHNNVIAVSGYNLVRRDRTKDQHGGVCIFIKDS 158 >SB_40429| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0036) Length = 311 Score = 35.1 bits (77), Expect = 0.009 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 4/40 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLIRNS 146 ETWL+ V + GY+ +R DR D +GGVC+ I++S Sbjct: 26 ETWLRNHIHNNVIAVSGYNLVRRDRTKDQHGGVCIFIKDS 65 >SB_39138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 624 Score = 35.1 bits (77), Expect = 0.009 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -3 Query: 253 ETWLKP---DFVFKIPGYSCLREDRADGYGGVCLLIR 152 ETW+K D F IPGY R+DR +GGV + R Sbjct: 333 ETWIKEGASDGEFDIPGYRLFRKDRKGNHGGVAVYAR 369 >SB_24349| Best HMM Match : Exo_endo_phos (HMM E-Value=0.001) Length = 534 Score = 35.1 bits (77), Expect = 0.009 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 4/40 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLIRNS 146 ETWL+ V + GY+ +R DR D +GGVC+ I++S Sbjct: 119 ETWLRNHIHNNVIAVSGYNLVRRDRTKDQHGGVCIFIKDS 158 >SB_9753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 35.1 bits (77), Expect = 0.009 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 4/40 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLIRNS 146 ETWL+ V + GY+ +R DR D +GGVC+ I++S Sbjct: 119 ETWLRNHIHNNVIAVSGYNLVRRDRTKDQHGGVCIFIKDS 158 >SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) Length = 1054 Score = 34.3 bits (75), Expect = 0.015 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTF 137 IPG+ +R+DR GGVCL +R+S + Sbjct: 373 IPGFDIIRKDRKRNGGGVCLYVRDSHNY 400 >SB_30214| Best HMM Match : Exo_endo_phos (HMM E-Value=6.1e-11) Length = 509 Score = 33.5 bits (73), Expect = 0.027 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGIC 68 D KI GY R+DR GGVC+ IR+S + P + C + Sbjct: 333 DAELKIHGYDIFRKDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFI 392 Query: 67 FVSIYVPHPSLQIFNEIKNLI 5 +Y P ++ FN + LI Sbjct: 393 VSVVYRPESPIEYFNRFEELI 413 >SB_6629| Best HMM Match : Lipase_GDSL (HMM E-Value=2.2) Length = 215 Score = 33.5 bits (73), Expect = 0.027 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGIC 68 D KI GY R+DR GGVC+ IR+S + P + C + Sbjct: 125 DAELKIHGYDIFRKDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFI 184 Query: 67 FVSIYVPHPSLQIFNEIKNLI 5 +Y P ++ FN + LI Sbjct: 185 VSVVYRPESPIEYFNRFEELI 205 >SB_17390| Best HMM Match : Exo_endo_phos (HMM E-Value=3.1e-13) Length = 851 Score = 33.1 bits (72), Expect = 0.035 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGIC 68 D KI GY R+DR GGVC+ IR+S + P + C + Sbjct: 392 DDELKIHGYDIFRKDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFI 451 Query: 67 FVSIYVPHPSLQIFNEIKNLI 5 +Y P ++ FN + LI Sbjct: 452 VSVVYRPESPIEYFNRFEELI 472 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 33.1 bits (72), Expect = 0.035 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGIC 68 D KI GY R+DR GGVC+ IR+S + P + C + Sbjct: 41 DDELKIHGYDIFRKDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFI 100 Query: 67 FVSIYVPHPSLQIFNEIKNLI 5 +Y P ++ FN + LI Sbjct: 101 VSVVYRPESPIEYFNRFEELI 121 >SB_1162| Best HMM Match : Exo_endo_phos (HMM E-Value=5.3e-08) Length = 285 Score = 33.1 bits (72), Expect = 0.035 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGIC 68 D KI GY R+DR GGVC+ IR+S + P + C + Sbjct: 120 DDELKIHGYDIFRKDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFI 179 Query: 67 FVSIYVPHPSLQIFNEIKNLI 5 +Y P ++ FN + LI Sbjct: 180 VSVVYRPESPIEYFNRFEELI 200 >SB_51484| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0036) Length = 283 Score = 33.1 bits (72), Expect = 0.035 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGIC 68 D KI GY R+DR GGVC+ IR+S + P + C + Sbjct: 13 DDELKIHGYDIFRKDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFI 72 Query: 67 FVSIYVPHPSLQIFNEIKNLI 5 +Y P ++ FN + LI Sbjct: 73 VSVVYRPESPIEYFNRFEELI 93 >SB_46645| Best HMM Match : Exo_endo_phos (HMM E-Value=0.044) Length = 464 Score = 33.1 bits (72), Expect = 0.035 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLK---PDFVFKIPGYSCLREDRADGY-GGVCLLI 155 ETWL PD + Y CLR+D A G GGVC+ I Sbjct: 220 ETWLNNSIPDSAIALHNYVCLRKDGAVGQCGGVCVYI 256 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 33.1 bits (72), Expect = 0.035 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGIC 68 D KI GY R+DR GGVC+ IR+S + P + C + Sbjct: 41 DDELKIHGYDIFRKDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFI 100 Query: 67 FVSIYVPHPSLQIFNEIKNLI 5 +Y P ++ FN + LI Sbjct: 101 VSVVYRPESPIEYFNRFEELI 121 >SB_4374| Best HMM Match : GCS (HMM E-Value=6.2) Length = 326 Score = 33.1 bits (72), Expect = 0.035 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLK---PDFVFKIPGYSCLREDRADGY-GGVCLLI 155 ETWL PD + Y CLR+D A G GGVC+ I Sbjct: 220 ETWLNNSIPDSAIALHNYVCLRKDGAVGQCGGVCVYI 256 >SB_4717| Best HMM Match : Exo_endo_phos (HMM E-Value=0.49) Length = 439 Score = 32.7 bits (71), Expect = 0.047 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -3 Query: 253 ETWLKPDF---VFKIPGYSCLREDRA-DGYGGVCLLI 155 E+WL PD +PG+ C R DR GGVC+ + Sbjct: 162 ESWLHPDIPDAAVNLPGFLCFRRDRTHTSGGGVCVYV 198 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 32.7 bits (71), Expect = 0.047 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGIC 68 D KI GY R+DR GGVC+ IR+S + P + C + Sbjct: 526 DAELKIHGYDISRKDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFI 585 Query: 67 FVSIYVPHPSLQIFNEIKNLI 5 +Y P ++ FN + LI Sbjct: 586 VSVVYRPESPIEYFNRFEELI 606 Score = 32.7 bits (71), Expect = 0.047 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGIC 68 D KI GY R+DR GGVC+ IR+S + P + C + Sbjct: 987 DAELKIHGYDISRKDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFI 1046 Query: 67 FVSIYVPHPSLQIFNEIKNLI 5 +Y P ++ FN + LI Sbjct: 1047 VSVVYRPESPIEYFNRFEELI 1067 >SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) Length = 547 Score = 32.3 bits (70), Expect = 0.062 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = -3 Query: 199 REDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSVIAAI--VDGICFVSIYVPHPSLQIF 26 R+DR DGYGGV L +++ S + L S + +I + + Y P S + Sbjct: 3 RKDRPDGYGGVLLAVKDLSCHELYELNSDCETVWIKVSINRTKHVYIGAFYNPDSSCEAL 62 Query: 25 NEIKNLIS 2 +E+ +S Sbjct: 63 DELDRSLS 70 >SB_44712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 31.9 bits (69), Expect = 0.082 Identities = 23/54 (42%), Positives = 26/54 (48%), Gaps = 11/54 (20%) Frame = -3 Query: 253 ETWL---KPDFVFKIPGYSCLREDRADGY--------GGVCLLIRNSSTFSSFP 125 ETWL K D GY +R DRADG GG+C IR +S FS P Sbjct: 429 ETWLDSTKSDNEVST-GYHIIRRDRADGKNVDNGESGGGICFYIRENSNFSLRP 481 >SB_30872| Best HMM Match : KID (HMM E-Value=4.7) Length = 294 Score = 31.9 bits (69), Expect = 0.082 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTFS 134 IPGY +R+DR G GGVC+ ++++ ++ Sbjct: 28 IPGYEIIRKDRKRG-GGVCIYVKSNINYT 55 >SB_53389| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10) Length = 774 Score = 31.5 bits (68), Expect = 0.11 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS 146 D KI GY R+DR GGVC+ IR+S Sbjct: 321 DDELKIHGYDIFRKDRNRDGGGVCVYIRSS 350 >SB_25449| Best HMM Match : Exo_endo_phos (HMM E-Value=7.4e-07) Length = 366 Score = 31.5 bits (68), Expect = 0.11 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -3 Query: 238 PDFVFKIPGYSCLREDRADGYGGVCLLIRNS 146 P+ +F P Y +R+D+ +G GG+ + IR++ Sbjct: 89 PNSLFNHPDYRVIRKDKKEGAGGILVFIRSN 119 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 31.5 bits (68), Expect = 0.11 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 238 PDFVFKIPGYSCLREDRADGYGGVCLLI 155 PD F + GYS R DR G GG+ LI Sbjct: 255 PDSQFSMAGYSLYRNDRKKGGGGIMALI 282 >SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 1102 Score = 31.5 bits (68), Expect = 0.11 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = -3 Query: 253 ETWLK---PDFVFKIPGYSCLREDR-ADGYGGVCL 161 ETWL PD + GY C R+DR A GG+C+ Sbjct: 465 ETWLNESIPDSTIHMSGYLCFRKDREARRGGGICV 499 >SB_32355| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1358 Score = 31.5 bits (68), Expect = 0.11 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = -3 Query: 253 ETWLK---PDFVFKIPGYSCLREDR-ADGYGGVCL 161 ETWL PD + GY C R+DR A GG+C+ Sbjct: 160 ETWLNESIPDSTIHMSGYLCFRKDREARRGGGICV 194 >SB_31839| Best HMM Match : Exo_endo_phos (HMM E-Value=1.3e-11) Length = 887 Score = 31.5 bits (68), Expect = 0.11 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 238 PDFVFKIPGYSCLREDRADGYGGVCLLI 155 PD F + GYS R DR G GG+ LI Sbjct: 276 PDSQFSMAGYSLYRNDRKKGGGGIMALI 303 >SB_7296| Best HMM Match : PHD (HMM E-Value=0.0013) Length = 873 Score = 31.1 bits (67), Expect = 0.14 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Frame = -3 Query: 265 IFSIETWLKPD---FVFKIPGYSCLREDRAD-GYGGVCLLIRNSSTFSSFPLPSHSN 107 IF E+ L P+ + P Y+ R+DR D G GGV + I++ SF P+H+N Sbjct: 816 IFGCESKLSPEDPTYSSFPPDYTVYRKDRLDSGGGGVFIAIKHD--IPSFASPNHNN 870 >SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) Length = 832 Score = 31.1 bits (67), Expect = 0.14 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -3 Query: 199 REDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSV 95 R+DR DGYGGV L +++ S + L +S+C +V Sbjct: 3 RKDRPDGYGGVLLAVKDLSCHELYEL--NSDCETV 35 >SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1623 Score = 30.7 bits (66), Expect = 0.19 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 8/87 (9%) Frame = -3 Query: 274 SFYIFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNC 104 S IF ET + + + GY R+DR G GG+ + LP Sbjct: 244 SHVIFLTETKIDSSYTNAQLALEGYHIYRKDRKKGGGGLMAYFSSKMASRKVKLPKQYKL 303 Query: 103 FSVIA--AIV--DGICFVSIY-VPHPS 38 V+A AI+ + + FV IY P+P+ Sbjct: 304 LEVLAINAIINNNNVLFVGIYRSPNPT 330 >SB_2748| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7e-08) Length = 438 Score = 30.7 bits (66), Expect = 0.19 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 8/87 (9%) Frame = -3 Query: 274 SFYIFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNC 104 S IF ET + + + GY R+DR G GG+ + LP Sbjct: 244 SHVIFLTETKIDSSYTNDQLALEGYHIYRKDRKKGGGGLMAYFSSKMASRKVKLPKQYRL 303 Query: 103 FSVIA--AIV--DGICFVSIY-VPHPS 38 V+A AI+ + + FV IY P+P+ Sbjct: 304 LEVLAINAIINNNNVLFVGIYRSPNPT 330 >SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 30.7 bits (66), Expect = 0.19 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 8/87 (9%) Frame = -3 Query: 274 SFYIFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNC 104 S IF ET + + + GY R+DR G GG+ + LP Sbjct: 892 SHVIFLTETKIDSSYTNAQLALEGYHIYRKDRKKGGGGLMAYFSSKMASCKVKLPKQYKL 951 Query: 103 FSVIA--AIV--DGICFVSIY-VPHPS 38 V+A AI+ + + FV IY P+P+ Sbjct: 952 LEVLAINAIINNNNVLFVGIYRSPNPT 978 >SB_3879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 30.7 bits (66), Expect = 0.19 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -3 Query: 214 GYSCLREDRADGYGGVCLLIRNSSTFSSF 128 GYS R+DR G GGV L I+ ST SSF Sbjct: 343 GYSIFRKDRVLGGGGVLLAIK--STLSSF 369 >SB_27477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1800 Score = 30.3 bits (65), Expect = 0.25 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 8/87 (9%) Frame = -3 Query: 274 SFYIFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNC 104 S IF ET + + + GY R+DR G GG+ + LP Sbjct: 1149 SHVIFLTETKIDSSYTNAQLALEGYHIYRKDRKKGGGGLMAYFSSKMASRKVKLPKQYKW 1208 Query: 103 FSVIA--AIV--DGICFVSIY-VPHPS 38 V+A AI+ + + FV IY P+P+ Sbjct: 1209 LEVLAINAIINNNNVLFVGIYRSPNPT 1235 Score = 25.0 bits (52), Expect = 9.4 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 63 TKQIPSTIAAMTEKQLLCE-GRGKEEKVLEFLMSRHTPPYPSALSS 197 T IP I + ++ C+ GR K+ M HT P+P+ L S Sbjct: 264 TDPIPLVIHTVASEEAACQVGR---TKLARGNMHEHTDPFPTGLES 306 >SB_34002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 29.9 bits (64), Expect = 0.33 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 238 PDFVFKIPGYSCLREDRADGYG-GVCLLIRN 149 PD FKIP Y R+DR G G C +RN Sbjct: 63 PDVQFKIPDYRIYRQDRVKGGGRKTCHGVRN 93 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 29.9 bits (64), Expect = 0.33 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -3 Query: 253 ETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIR 152 E W+K D F IPGY R++R GGV + R Sbjct: 932 ENWIKEDASYGEFDIPGYRLFRKNRKGNNGGVAVYAR 968 >SB_17643| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00047) Length = 305 Score = 29.9 bits (64), Expect = 0.33 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 8/87 (9%) Frame = -3 Query: 274 SFYIFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNC 104 S IF ET + + + GY R+DR G GG+ + LP Sbjct: 118 SHVIFLTETKIDSSYTNAQLALEGYHIYRKDRKKGGGGLMANFSSKMASRKVKLPKQYKL 177 Query: 103 FSVIA--AIV--DGICFVSIY-VPHPS 38 V+A AI+ + + FV IY P+P+ Sbjct: 178 LEVLAINAIINNNNVLFVGIYRSPNPT 204 >SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 707 Score = 29.5 bits (63), Expect = 0.44 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -3 Query: 253 ETWLK---PDFVFKIPGYSCLREDRADGYGGVCLLIRNS 146 ETWL PD + Y+ R+DR GG+ IR S Sbjct: 132 ETWLSEVIPDSQVSLQDYTLFRKDRPTQAGGIAAFIRTS 170 >SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 29.5 bits (63), Expect = 0.44 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -3 Query: 253 ETWL---KPDFVFKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSH 113 ETWL P+ + GY+ R+DR GG+ + + SS+ + L SH Sbjct: 158 ETWLTDNNPNDAVALSGYNLFRKDRGSRGGGIAVYV--SSSIRARRLESH 205 >SB_2904| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 29.5 bits (63), Expect = 0.44 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSVIA--AIV--DGICFVSIY 53 + GY R+DR G GG+ + LP V+A AI+ + + FV IY Sbjct: 15 LEGYHIYRKDRKKGGGGLMAYFSSKMASRKVKLPKQYKLLEVLAINAIINNNNVLFVGIY 74 Query: 52 -VPHPS 38 P+P+ Sbjct: 75 RSPNPA 80 >SB_50943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 29.1 bits (62), Expect = 0.58 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -3 Query: 253 ETWLK---PDFVFKIPGYSCLREDRADGYGGVCLLIRNS 146 ETWL PD + Y+ R+DR GG+ IR S Sbjct: 111 ETWLSEMIPDSHVSLQDYTLFRKDRPTHAGGIAAFIRTS 149 >SB_45939| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00051) Length = 575 Score = 28.7 bits (61), Expect = 0.76 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -3 Query: 265 IFSIETWLKPDF----VFKIPGYSCLREDRADGYGG 170 +F E+WLKPD VF Y LR+DR + GG Sbjct: 185 VFGNESWLKPDISSAEVFP-ENYKILRKDRDNNRGG 219 >SB_39504| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00014) Length = 217 Score = 28.7 bits (61), Expect = 0.76 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -3 Query: 265 IFSIETWLKPDF----VFKIPGYSCLREDRADGYGG 170 +F E+WLKPD VF Y LR+DR + GG Sbjct: 21 VFGNESWLKPDISSAEVFP-ENYKILRKDRDNNRGG 55 >SB_3206| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00047) Length = 256 Score = 28.7 bits (61), Expect = 0.76 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -3 Query: 265 IFSIETWLKPD---FVFKIPGYSCLREDRAD-GYGGVCLLIRNSSTFSSFPLPSHS 110 IF E+ L P+ + P Y+ R+DR D G GGV + I++ SF P+H+ Sbjct: 23 IFGCESKLSPEDPTYSSFPPDYTVYRKDRLDSGGGGVFIAIKHD--IPSFASPNHT 76 >SB_1792| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7e-11) Length = 476 Score = 28.7 bits (61), Expect = 0.76 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -3 Query: 265 IFSIETWLKPDF----VFKIPGYSCLREDRADGYGG 170 +F E+WLKPD VF Y LR+DR + GG Sbjct: 238 VFGNESWLKPDISSAEVFP-ENYKILRKDRDNNRGG 272 >SB_1356| Best HMM Match : GCV_T (HMM E-Value=5.1e-40) Length = 1006 Score = 28.7 bits (61), Expect = 0.76 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -3 Query: 265 IFSIETWLKPDF----VFKIPGYSCLREDRADGYGG 170 +F E+WLKPD VF Y LR+DR + GG Sbjct: 754 VFGNESWLKPDISSAEVFP-ENYKILRKDRDNNRGG 788 >SB_84| Best HMM Match : PHD (HMM E-Value=0.0019) Length = 402 Score = 28.7 bits (61), Expect = 0.76 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -3 Query: 265 IFSIETWLKPDF----VFKIPGYSCLREDRADGYGG 170 +F E+WLKPD VF Y LR+DR + GG Sbjct: 332 VFGNESWLKPDISSAEVFP-ENYKILRKDRDNNRGG 366 >SB_52105| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0012) Length = 241 Score = 28.7 bits (61), Expect = 0.76 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -3 Query: 265 IFSIETWLKPD---FVFKIPGYSCLREDRAD-GYGGVCLLIRNSSTFSSFPLPSHS 110 IF E+ L P+ + P Y+ R+DR D G GGV + I++ SF P+H+ Sbjct: 53 IFGCESKLSPEDPTYSSFPPDYTVYRKDRLDSGGGGVFIAIKHD--IPSFASPNHT 106 >SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) Length = 867 Score = 28.7 bits (61), Expect = 0.76 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = -3 Query: 253 ETWL---KPDFVFKIPGYSCLREDRADGYGGVCLLIRNS 146 ETWL P+ + GY+ R+DR GG+ + + +S Sbjct: 158 ETWLTDNNPNDAVALSGYNLFRKDRGSRGGGIAVYVSSS 196 >SB_23583| Best HMM Match : TSP_1 (HMM E-Value=0.095) Length = 520 Score = 28.3 bits (60), Expect = 1.0 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -3 Query: 253 ETWLKP---DFVFKIPGYSCLREDRADGYGGVCLLIRNS 146 ETW D I GY+ LR DR+ GGV + +S Sbjct: 411 ETWFSDQISDASVAISGYNLLRNDRSGNAGGVSAYVHSS 449 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 214 GYSCLREDRADGYGGVCLLIRNS 146 GYS R+DR G GGV L I++S Sbjct: 296 GYSVFRKDRILGGGGVFLAIKSS 318 >SB_56875| Best HMM Match : LON (HMM E-Value=0) Length = 925 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 214 GYSCLREDRADGYGGVCLLIRNS 146 GYS R+DR G GGV L I+++ Sbjct: 572 GYSIFRKDRVLGGGGVLLAIKST 594 >SB_53562| Best HMM Match : Exo_endo_phos (HMM E-Value=0.018) Length = 721 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = -3 Query: 253 ETWLKP---DFVFKIPGYSCLREDRADGYGGVCLLI 155 ETWL D + Y+ R DR +GGVC+ + Sbjct: 153 ETWLSSSSLDSAVTMKDYTIFRRDRPTLFGGVCVYV 188 >SB_50541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS 146 D + I G++ +R+DR G GGV +R++ Sbjct: 26 DSLIGISGFNLIRKDRTRGGGGVVAYVRDT 55 >SB_41990| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) Length = 455 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 214 GYSCLREDRADGYGGVCLLIRNS 146 GYS R+DR G GGV L I+++ Sbjct: 102 GYSIFRKDRVLGGGGVLLAIKST 124 >SB_33668| Best HMM Match : DUF1590 (HMM E-Value=9.5) Length = 122 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 235 DFVFKIPGYSCLREDRADGYGGVCLLIRNS 146 D + I G++ +R+DR G GGV +R++ Sbjct: 75 DSLIGISGFNLIRKDRTRGGGGVVAYVRDT 104 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 27.5 bits (58), Expect = 1.8 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +2 Query: 23 IEDLQGGMRDIDRDKTDTINNSCNDRKAVTM*REREGRKGARVSDE*AYTT 175 IED Q G+ D R K + ++ DR++ + RER R +R D + T+ Sbjct: 1571 IEDKQFGLDDDRRRKRSSKSSKKRDRRSRSRSRERRRRSKSRDRDSRSRTS 1621 >SB_26795| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10) Length = 609 Score = 27.1 bits (57), Expect = 2.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRN 149 I GY +R DR GGVC+ I++ Sbjct: 220 INGYDIIRSDRNTRGGGVCIYIKS 243 >SB_46140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 748 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTFSS 131 + GY R+DR G GGV + + S SS Sbjct: 349 LQGYEIYRQDRKCGGGGVLVATKQDSIISS 378 >SB_15382| Best HMM Match : Exo_endo_phos (HMM E-Value=2.2e-06) Length = 493 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTFSS 131 + GY R+DR G GGV + + S SS Sbjct: 200 LQGYEIYRQDRKCGGGGVLVATKQDSIISS 229 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTFSS 131 + GY R+DR G GGV + + S SS Sbjct: 120 LQGYEIYRQDRKCGGGGVLVATKQDSIISS 149 >SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) Length = 805 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTFSS 131 + GY R+DR G GGV + + S SS Sbjct: 120 LQGYEIYRQDRKCGGGGVLVATKQDSIISS 149 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTFSS 131 + GY R+DR G GGV + + S SS Sbjct: 500 LQGYEIYRQDRKCGGGGVLVATKQDSIISS 529 >SB_14881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 26.6 bits (56), Expect = 3.1 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 268 YIFSIETWLK---PDFVFKIPGYSCLREDRADGYGGVCLLIR 152 ++ ETWL PD ++ Y R+DR GGV +R Sbjct: 164 FVCITETWLHKQIPDSAVQMRDYVLFRKDRPSHDGGVAAYVR 205 >SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1837 Score = 26.6 bits (56), Expect = 3.1 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -3 Query: 253 ETWLK---PDFVFKIPGYSCLREDRADGYGGVCLLIR 152 ETWL PD ++ Y R+DR GGV +R Sbjct: 1122 ETWLHEQIPDSAVQMRDYVLFRKDRPSHAGGVAAYVR 1158 >SB_6377| Best HMM Match : Exo_endo_phos (HMM E-Value=6.5e-10) Length = 450 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTFSS 131 + GY R+DR G GGV + + S SS Sbjct: 265 LQGYEIYRQDRKCGGGGVLVATKQDSIISS 294 >SB_2883| Best HMM Match : Exo_endo_phos (HMM E-Value=2.1e-09) Length = 598 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 220 IPGYSCLREDRADGYGGVCLLIRNSSTFSS 131 + GY R+DR G GGV + + S SS Sbjct: 262 LQGYEIYRQDRKCGGGGVLVATKQESIISS 291 >SB_19882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 214 GYSCLREDRADGYGGVCLLIRNS 146 GYS R++R G GGV L I+++ Sbjct: 200 GYSTFRKNRVIGSGGVLLAIKST 222 >SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1808 Score = 26.2 bits (55), Expect = 4.1 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -3 Query: 253 ETWLKP---DFVFKIPGYSCLREDRADGYGGVCLLIRNS 146 ETWL D + Y+ LR+DR GGV I N+ Sbjct: 949 ETWLCDSITDTAMVMSNYNLLRKDRPSHGGGVAAYIHNT 987 >SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) Length = 775 Score = 26.2 bits (55), Expect = 4.1 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = -3 Query: 274 SFYIFSIETWLKPDFV---FKIPGYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSH 113 S IF ET + + + GY R+DR G GG+ + LP H Sbjct: 244 SHVIFLTETKIDSSYTNAQLALEGYHIYRKDRKKGGGGLMAYFSSKMASRKVKLPKH 300 >SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 118 SHSNCFSVIAAIVDGICFVSIYVPHPSLQI 29 S +NCF++ A C V IY P +L++ Sbjct: 56 SSNNCFTLYFAAKYKFCCVGIYCPQCTLKV 85 >SB_58916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 25.4 bits (53), Expect = 7.1 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -3 Query: 115 HSNCFSVIAAIVDGI-CFVSIYVPHPSLQIFNEIKN 11 H+N SVI V I FVS PH L N++KN Sbjct: 239 HTNLASVIYLHVKEIPWFVSDTTPHDVLWTLNQLKN 274 >SB_27034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 50 DIDRDKTDTINNSCNDRKAVTM*REREGRK 139 D D ++ INN+ + +KA + +ER+ RK Sbjct: 196 DYDEEEESNINNNESKKKASSNLKERKSRK 225 >SB_11891| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-35) Length = 1171 Score = 25.4 bits (53), Expect = 7.1 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Frame = -3 Query: 253 ETWLKP-DFVFKIP----GYSCLREDRADGY-GGVCLLIRNSSTFSS 131 E WL P D K GYSC+ + R + + GG LL R+S S+ Sbjct: 676 EHWLSPSDLAVKTEMCPQGYSCVLQSRPNRHGGGTGLLYRDSFDVST 722 >SB_59443| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) Length = 942 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 278 GLVNQVANYAQLRETMAPFKPFLS 301 >SB_57416| Best HMM Match : rve (HMM E-Value=0.0011) Length = 807 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 108 LLCEGRGKEEKVLEFLMSRHT 170 LLC G +E V E+LM+ HT Sbjct: 203 LLCWSDGDQENVDEYLMTVHT 223 >SB_57121| Best HMM Match : FCD (HMM E-Value=9.4) Length = 291 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 53 GLVNQVANYAQLRETMAPFKPFLS 76 >SB_54562| Best HMM Match : RVT_1 (HMM E-Value=1.4e-06) Length = 909 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 586 GLVNQVANYAQLRETMAPFKPFLS 609 >SB_52359| Best HMM Match : FCD (HMM E-Value=7.8) Length = 208 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 58 GLVNQVANYAQLRETMAPFKPFLS 81 >SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) Length = 1286 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 817 GLVNQVANYAQLRETMAPFKPFLS 840 >SB_36517| Best HMM Match : RVT_1 (HMM E-Value=1.4e-06) Length = 817 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 630 GLVNQVANYAQLRETMAPFKPFLS 653 >SB_22667| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) Length = 795 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 667 GLVNQVANYAQLRETMAPFKPFLS 690 >SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) Length = 389 Score = 25.0 bits (52), Expect = 9.4 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +2 Query: 50 DIDRDKTDTINNSCNDRKAVTM*REREGRKGARVSDE*AYTTISISPVFS*ARITRD 220 D+D D + +++ + + R R GRK S +T SP+FS + I R+ Sbjct: 127 DLDEDVEEQLSSDDEEVELGKRRRGRPGRKKGYGSSSQLHTVPRPSPLFSGSMIVRN 183 >SB_20587| Best HMM Match : rve (HMM E-Value=7.2e-15) Length = 1485 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 931 GLVNQVANYAQLRETMAPFKPFLS 954 >SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11) Length = 1213 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 450 GLVNQVANYAQLRETMAPFKPFLS 473 >SB_9289| Best HMM Match : EGF_2 (HMM E-Value=6.1) Length = 355 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 103 GLVNQVANYAQLRETMAPFKPFLS 126 >SB_4623| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) Length = 452 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 380 GLVNQVANYAQLRETMAPFKPFLS 403 >SB_57312| Best HMM Match : RVT_1 (HMM E-Value=0.0069) Length = 503 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 225 GLVNQVANYAQLRETMAPFKPFLS 248 >SB_35469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 906 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 834 GLVNQVANYAQLRETMAPFKPFLS 857 >SB_34271| Best HMM Match : RVT_1 (HMM E-Value=3.4e-07) Length = 303 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 278 GLVNQVANYAQLRETMAPFKPFLS 301 >SB_33139| Best HMM Match : EGF_2 (HMM E-Value=6.1) Length = 337 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 34 GLVNQVANYAQLRETMAPFKPFLS 57 >SB_24375| Best HMM Match : rve (HMM E-Value=7.2e-15) Length = 638 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 113 GLVNQVANYAQLRETMAPFKPFLS 136 >SB_4973| Best HMM Match : RVT_1 (HMM E-Value=8.6e-11) Length = 296 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 189 GLMDMVV-YAYSSETLAPFLPSLS 121 GL++ V YA ET+APF P LS Sbjct: 224 GLVNQVANYAQLRETMAPFKPFLS 247 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 25.0 bits (52), Expect = 9.4 Identities = 18/69 (26%), Positives = 28/69 (40%), Gaps = 4/69 (5%) Frame = -3 Query: 199 REDRADGYGGVCLLIRNS----STFSSFPLPSHSNCFSVIAAIVDGICFVSIYVPHPSLQ 32 +EDR GGVC+ IR+S + P + C + +Y P ++ Sbjct: 250 QEDRNRDGGGVCVYIRSSINCVNRKEIVPEDVEAVCLEIRKPNSRPFIVSVVYRPESPIE 309 Query: 31 IFNEIKNLI 5 FN + LI Sbjct: 310 YFNRFEELI 318 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,705,964 Number of Sequences: 59808 Number of extensions: 132226 Number of successful extensions: 501 Number of sequences better than 10.0: 123 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 16,821,457 effective HSP length: 70 effective length of database: 12,634,897 effective search space used: 290602631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -