BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40285 (634 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787,643... 93 2e-19 02_01_0450 + 3234378-3234834,3235118-3235223,3235722-3235920,323... 31 0.58 01_01_0268 - 2214923-2215048,2215131-2215286,2215371-2215469,221... 31 0.58 04_04_0251 + 23930789-23930960,23931065-23931128,23931641-239317... 31 0.76 08_02_0657 - 19749835-19751942,19753123-19753561 30 1.8 02_02_0700 + 13058446-13058790,13059352-13059582,13060083-130602... 30 1.8 01_01_0270 - 2225250-2225263,2225549-2225732,2225817-2225972,222... 30 1.8 02_04_0187 - 20757713-20758632,20759056-20759812 29 2.3 08_02_1311 - 26039741-26039930,26040185-26040316,26040528-260406... 29 3.1 01_01_0886 - 6970112-6970225,6970357-6970473,6970567-6970635,697... 29 3.1 11_06_0511 - 24434007-24436814 29 4.1 06_03_1386 + 29816744-29816941,29817030-29817330,29817421-298175... 29 4.1 05_07_0274 - 28873531-28873644,28873727-28873981,28874111-288741... 29 4.1 02_05_0449 - 29107310-29107377,29107732-29107777,29107860-291079... 29 4.1 11_06_0634 - 25685216-25685329,25685407-25685511,25685681-256857... 28 5.4 10_08_0170 + 15397381-15397418,15397519-15397681,15398419-153986... 28 5.4 07_03_1647 + 28370226-28370369,28370452-28370611,28370704-283708... 28 5.4 06_03_1068 - 27341103-27341444,27341689-27341929,27342030-273423... 28 5.4 06_03_0711 + 23798998-23799106,23799838-23799957,23800181-238003... 28 5.4 06_01_0876 - 6712224-6712812,6713777-6715233 28 5.4 04_04_1163 - 31398565-31398654,31398729-31398812,31398893-313990... 28 5.4 03_02_0971 - 12807981-12808094,12808949-12809053,12809236-128092... 28 5.4 03_01_0393 - 3062859-3062972,3063027-3063311,3063472-3063759,306... 28 5.4 03_01_0364 - 2834446-2834742,2834838-2835197,2835281-2835562,283... 28 5.4 02_01_0754 - 5595813-5595887,5595973-5596071,5596136-5596327,559... 28 5.4 01_06_0763 + 31800556-31800618,31800659-31800802,31800859-318009... 28 5.4 01_06_0221 - 27653591-27653724,27654270-27654473,27655216-276553... 28 5.4 01_01_0939 - 7404209-7404490,7405057-7405368,7405470-7405609,740... 28 5.4 11_03_0227 + 11934530-11934638,11937206-11937351,11937492-119376... 28 7.1 06_03_0772 + 24483314-24486781,24487148-24487240,24488366-24488458 28 7.1 06_01_0860 - 6514921-6515034,6515125-6515196,6515344-6515400,651... 28 7.1 11_06_0325 + 22376195-22377001,22377136-22377525,22377638-223777... 27 9.4 09_02_0226 - 6007656-6008063,6012166-6012678 27 9.4 06_01_0469 + 3322886-3323564,3324033-3324953,3325025-3325155,332... 27 9.4 06_01_0209 + 1587656-1587876,1587964-1588055,1590520-1590545,159... 27 9.4 02_05_0752 + 31491462-31491921,31492177-31492271,31492346-314925... 27 9.4 02_04_0175 + 20642877-20643618,20643844-20643955,20644052-206441... 27 9.4 02_01_0137 + 988442-988641,989088-989281,989369-989488,989594-98... 27 9.4 01_06_1252 - 35748000-35748173,35748243-35748375,35749771-357498... 27 9.4 01_05_0749 + 24890944-24891146,24891414-24891535,24891633-248917... 27 9.4 >02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787, 6435281-6435392,6435473-6435517,6435622-6435726, 6435946-6435996,6436026-6436103,6437258-6437313, 6437784-6437853,6438288-6438392,6438525-6438637, 6439354-6439534,6439635-6440390 Length = 710 Score = 93.1 bits (221), Expect = 2e-19 Identities = 51/127 (40%), Positives = 81/127 (63%), Gaps = 10/127 (7%) Frame = -1 Query: 634 DNLVIILRGPPGSGKSYLAKLIRDKEAEHGGTA-RIMSIDDYFC--KKERLEERDPTTG- 467 D++VIILRG PGSGKSYLAK +RD E E+GG A RI S+DDYF ++++E+ + + Sbjct: 302 DHIVIILRGLPGSGKSYLAKALRDLEVENGGNAPRIHSMDDYFMIEVEKKVEDNEGSKSS 361 Query: 466 ------KTIKKPTLKYEFDKDCEESYVNSLKRAFKRSITDGYFSFLIYDAVNDLHRHYAD 305 K + K ++Y ++ + EE+Y +S+ AFK+++ +G F+F+I D N +A Sbjct: 362 STSKGRKQLTKKVIEYCYEPEMEETYRSSMLNAFKKTLDEGNFTFVIVDDRNLRVADFAQ 421 Query: 304 IWNFARQ 284 W A++ Sbjct: 422 FWASAKE 428 Score = 36.7 bits (81), Expect = 0.015 Identities = 19/75 (25%), Positives = 34/75 (45%) Frame = -3 Query: 248 DPQVCYKRNIHNRTLEDIEIICTRFFPTPSHHIQLDPTTLLQSAAITDVHMEDVQDEVIA 69 DP C RN+H T++D+ + + P +++LD +L + + +++V E Sbjct: 468 DPTGCAARNVHGFTVDDVNKMAADWEEAPPLYLRLDIHSLFNDDNLREHSIQEVDMETED 527 Query: 68 DDTRETERNSTEPAN 24 D STE N Sbjct: 528 TDGASNTATSTEAEN 542 >02_01_0450 + 3234378-3234834,3235118-3235223,3235722-3235920, 3236119-3236187,3236299-3236373,3236484-3236582, 3236694-3236864,3237394-3237519 Length = 433 Score = 31.5 bits (68), Expect = 0.58 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 619 ILRGPPGSGKSYLAKLI 569 +L GPPG+GKSYLAK + Sbjct: 162 LLYGPPGTGKSYLAKAV 178 >01_01_0268 - 2214923-2215048,2215131-2215286,2215371-2215469, 2215557-2215631,2215732-2215800,2216515-2216713, 2220162-2220267,2221117-2221588 Length = 433 Score = 31.5 bits (68), Expect = 0.58 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 619 ILRGPPGSGKSYLAKLI 569 +L GPPG+GKSYLAK + Sbjct: 167 LLYGPPGTGKSYLAKAV 183 >04_04_0251 + 23930789-23930960,23931065-23931128,23931641-23931747, 23931832-23931899,23932068-23932097,23932357-23932460, 23932558-23932662,23932815-23932904,23932982-23933057, 23933292-23933361,23933799-23933869,23933945-23934035, 23934192-23934319,23934547-23934675,23934762-23934902 Length = 481 Score = 31.1 bits (67), Expect = 0.76 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 631 NLVIILRGPPGSGKSYLAKLIRDK 560 N +++L GPPG+GK+ L K + K Sbjct: 216 NRIVLLHGPPGTGKTSLCKALAQK 239 >08_02_0657 - 19749835-19751942,19753123-19753561 Length = 848 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDKEAEH 548 I+L GPPG+GK+ LA+ I + H Sbjct: 252 ILLYGPPGTGKTLLARAIAAESGAH 276 >02_02_0700 + 13058446-13058790,13059352-13059582,13060083-13060241, 13060483-13060635,13061619-13061702,13061847-13061915, 13062374-13062421,13062487-13062621 Length = 407 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDKEAEHGGTARIMSIDDYFCKK 500 ++L GPPG+GK+ LAK + A H A I + F +K Sbjct: 152 VLLYGPPGTGKTMLAKAV----AHHTTAAFIRVVGSEFVQK 188 >01_01_0270 - 2225250-2225263,2225549-2225732,2225817-2225972, 2226276-2226374,2226489-2226563,2226682-2226750, 2226917-2227115,2227492-2227597,2228118-2228526 Length = 436 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -1 Query: 619 ILRGPPGSGKSYLAKLI 569 +L GPPG+GKSYLA+ + Sbjct: 146 LLYGPPGTGKSYLAEAV 162 >02_04_0187 - 20757713-20758632,20759056-20759812 Length = 558 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -1 Query: 568 RDKEAEHGGTARIMSIDDYFCKKERLEERDPTTGKTIKKP 449 + K++ GT RI + DYFC KE L+E + T P Sbjct: 119 KGKQSYFTGTKRIRT-KDYFCSKEGLKEGERLTDANFNDP 157 >08_02_1311 - 26039741-26039930,26040185-26040316,26040528-26040676, 26040807-26040893,26041338-26041420,26042008-26042137 Length = 256 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDKEAEHGGTARIMSIDDYFCKKERLEER 482 I+L G GSGK+ L +RD G + +D F LE R Sbjct: 55 IVLSGLSGSGKTILFYQLRDGSTHQGTVTSMEQNNDTFVLHSELERR 101 >01_01_0886 - 6970112-6970225,6970357-6970473,6970567-6970635, 6970711-6970849,6970964-6971532,6971799-6971966, 6972097-6972184,6972260-6972818,6972924-6973024, 6973113-6973155,6973845-6973938,6974160-6974215, 6974460-6974581,6975306-6975517 Length = 816 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDK 560 I+L GPPG+GK+ LAK I ++ Sbjct: 545 ILLFGPPGTGKTMLAKAIANE 565 >11_06_0511 - 24434007-24436814 Length = 935 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -1 Query: 625 VIILRGPPGSGKSYLAKLIRDKEAEHGGTARIMSI 521 VI + G PGSGK++L K + E ++ T+ +SI Sbjct: 221 VIAVYGQPGSGKTHLVKDVYASEKKYFSTSAWISI 255 >06_03_1386 + 29816744-29816941,29817030-29817330,29817421-29817579, 29818916-29819211,29819534-29819761 Length = 393 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 ++L GPPG+GK+ LAK I Sbjct: 122 VLLYGPPGTGKTMLAKAI 139 >05_07_0274 - 28873531-28873644,28873727-28873981,28874111-28874179, 28874277-28874415,28874511-28875076,28875225-28875326, 28875425-28875491,28875576-28876072,28876148-28876212, 28876470-28876567,28876652-28876694,28876870-28876963, 28877325-28877360,28877454-28877542,28877667-28877788, 28878193-28878404 Length = 855 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 I+L GPPG+GK+ LAK I Sbjct: 538 ILLFGPPGTGKTMLAKAI 555 >02_05_0449 - 29107310-29107377,29107732-29107777,29107860-29107934, 29108053-29108122,29108313-29108408,29108728-29108914, 29109001-29109169,29109614-29109646,29109731-29109841, 29110070-29111256,29112380-29112448,29114417-29114975, 29115455-29115589,29115714-29115896 Length = 995 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 II +GPPGSGKS L + + Sbjct: 720 IIFKGPPGSGKSSLCRAV 737 >11_06_0634 - 25685216-25685329,25685407-25685511,25685681-25685740, 25685827-25685965,25686056-25686240,25686328-25686411, 25686499-25686621,25687088-25687267,25687364-25687433, 25687520-25687616,25687695-25687770,25688259-25688348, 25688383-25688529,25688647-25688715,25689004-25689177, 25689266-25689336,25689409-25689557,25690723-25690774, 25690865-25691120,25691196-25691287,25691420-25691541, 25691909-25692679,25692883-25692940,25693068-25693107, 25694462-25694595,25694685-25694793,25694896-25694991 Length = 1220 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 I+L GPPG+GK+ LAK + Sbjct: 956 ILLFGPPGTGKTMLAKAV 973 >10_08_0170 + 15397381-15397418,15397519-15397681,15398419-15398647, 15398777-15399543,15399650-15399871,15399961-15400032, 15400100-15400408,15400491-15400850,15401199-15401492 Length = 817 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDK 560 I+L GPPGSGK+ +A+ + ++ Sbjct: 247 ILLYGPPGSGKTLIARAVANE 267 >07_03_1647 + 28370226-28370369,28370452-28370611,28370704-28370831, 28372512-28372628,28372729-28372782,28372985-28373075, 28373517-28373688,28374452-28374573,28374726-28374817, 28375331-28375373,28375596-28375656,28376367-28376515, 28376659-28376729,28376805-28376975,28377056-28377124, 28377427-28377528,28377629-28377697,28378060-28378138, 28378238-28378337,28378438-28378513,28378715-28378894, 28379430-28379552,28379634-28379717,28380068-28380252, 28380339-28380477,28380585-28380644,28380926-28381030, 28381332-28381445 Length = 1019 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 I+L GPPG+GK+ LAK + Sbjct: 755 ILLFGPPGTGKTMLAKAV 772 >06_03_1068 - 27341103-27341444,27341689-27341929,27342030-27342343, 27342672-27343805 Length = 676 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 ++L GPPG+GK+ LAK I Sbjct: 250 VLLVGPPGTGKTLLAKAI 267 >06_03_0711 + 23798998-23799106,23799838-23799957,23800181-23800317, 23800418-23800579,23800707-23800793,23800872-23800958, 23801317-23801454,23802023-23802214,23802287-23802385, 23802490-23802564 Length = 401 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDK-EAEHGGTARIMSIDDYFCKKERL 491 ++L GPPG+GK+ LA+ I +A ID Y + RL Sbjct: 178 VLLYGPPGTGKTLLARAIASNIDANFLKIVSSAIIDKYIGESARL 222 >06_01_0876 - 6712224-6712812,6713777-6715233 Length = 681 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 ++L GPPG+GK+ LAK I Sbjct: 252 VLLVGPPGTGKTLLAKAI 269 >04_04_1163 - 31398565-31398654,31398729-31398812,31398893-31399037, 31399118-31399239,31399338-31399376,31399491-31399601, 31399682-31399804,31399946-31400032,31400136-31400207, 31400349-31400621,31400704-31400895,31400988-31401171, 31401339-31401480,31401578-31401821,31401959-31402603, 31403024-31403293 Length = 940 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 ++L GPPG+GK+ LAK + Sbjct: 693 VLLYGPPGTGKTLLAKAV 710 >03_02_0971 - 12807981-12808094,12808949-12809053,12809236-12809295, 12809399-12809537,12809648-12809832,12809926-12810009, 12810093-12810215,12810617-12810796,12811017-12811092, 12811178-12811277,12811355-12811430,12812155-12812244, 12812342-12812449,12813583-12813651,12813751-12813921, 12814002-12814072,12814263-12814360,12814659-12814719, 12814935-12814971,12815217-12815308,12815428-12815549, 12816281-12816414 Length = 764 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 I+L GPPG+GK+ LAK + Sbjct: 500 ILLFGPPGTGKTMLAKAV 517 >03_01_0393 - 3062859-3062972,3063027-3063311,3063472-3063759, 3063844-3064161,3064232-3064415,3064504-3064659, 3066394-3066620,3066734-3066804,3067090-3067534 Length = 695 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 625 VIILRGPPGSGKSYLAKLIRDKEAEHGGTARIMSI-DDYFCK 503 V+ L GP GSGK+ L ++ + A G +S D+ +CK Sbjct: 202 VLALMGPSGSGKTTLLSILGGRVAGPGDVEGCVSYNDEPYCK 243 >03_01_0364 - 2834446-2834742,2834838-2835197,2835281-2835562, 2835634-2835705,2835798-2836019,2836105-2836871, 2837206-2837434,2838027-2838189,2838313-2838350 Length = 809 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDK 560 I+L GPPGSGK+ +A+ + ++ Sbjct: 247 ILLYGPPGSGKTLIARAVANE 267 >02_01_0754 - 5595813-5595887,5595973-5596071,5596136-5596327, 5596992-5597129,5597415-5597501,5597583-5597669, 5597795-5597956,5598089-5598225,5598483-5598602, 5600668-5600773 Length = 400 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDK-EAEHGGTARIMSIDDYFCKKERL 491 ++L GPPG+GK+ LA+ I +A ID Y + RL Sbjct: 177 VLLYGPPGTGKTLLARAIASNIDANFLKIVSSAIIDKYIGESARL 221 >01_06_0763 + 31800556-31800618,31800659-31800802,31800859-31800980, 31801742-31801807,31801891-31801998,31802226-31802292, 31802716-31802800,31803169-31803329,31803490-31803591, 31803807-31804029,31804155-31804300 Length = 428 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 I+L GPPG+GK+ LAK + Sbjct: 180 ILLFGPPGTGKTMLAKAV 197 >01_06_0221 - 27653591-27653724,27654270-27654473,27655216-27655315, 27655728-27655888,27656846-27656930,27657548-27657614, 27658434-27658541,27658639-27658704,27659341-27659387, 27659497-27659691,27659833-27659877 Length = 403 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 I+L GPPG+GK+ LAK + Sbjct: 166 ILLFGPPGTGKTMLAKAV 183 >01_01_0939 - 7404209-7404490,7405057-7405368,7405470-7405609, 7406226-7406289,7406378-7406616,7406957-7406983, 7407590-7407749 Length = 407 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -1 Query: 445 LKYEFDKDCEESYVNSLKRAFKRSITDGYFSFLIYDAVNDLHRHY 311 L + + +C S V+S+ R S +DGY F +D V D HY Sbjct: 91 LVQKHEPECS-SVVSSMTRTEYGSESDGYNLFNQFDVVQDFSDHY 134 >11_03_0227 + 11934530-11934638,11937206-11937351,11937492-11937611, 11937731-11937898,11938534-11938623,11938920-11939018 Length = 243 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDK 560 +IL GPPGSGK + +I+D+ Sbjct: 33 LILVGPPGSGKGTQSPIIKDE 53 >06_03_0772 + 24483314-24486781,24487148-24487240,24488366-24488458 Length = 1217 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = -1 Query: 427 KDCEESYVNSL--KRAFKRSITDGYFSFLIYDAVNDLHRH 314 +D + Y N L + F+RS+ D ++++D +NDL R+ Sbjct: 480 EDVAKGYFNDLVQRSFFERSLLDLPIEYVMHDLINDLARN 519 >06_01_0860 - 6514921-6515034,6515125-6515196,6515344-6515400, 6515512-6515650,6515737-6515921,6516043-6516126, 6516552-6516674,6518043-6518219,6518331-6518400, 6518478-6518574,6519022-6519097,6519240-6519329, 6519548-6519655,6520715-6520756,6520854-6521045, 6521239-6521309,6521396-6521550,6521999-6522064, 6522769-6522820,6523476-6523566,6523897-6524094, 6524173-6524267,6524361-6524485,6524586-6525016 Length = 969 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 I+L GPPG+GK+ LAK + Sbjct: 717 ILLFGPPGTGKTLLAKAL 734 >11_06_0325 + 22376195-22377001,22377136-22377525,22377638-22377778, 22377888-22378067,22378268-22378447,22378536-22378637, 22378768-22378896,22379318-22379422,22379528-22379623 Length = 709 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLIRDKEAEHGG 542 I + GP G GKS L KLI E GG Sbjct: 462 IAIIGPNGCGKSTLLKLILGMEKTQGG 488 >09_02_0226 - 6007656-6008063,6012166-6012678 Length = 306 Score = 27.5 bits (58), Expect = 9.4 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 3/86 (3%) Frame = -3 Query: 275 PGIRMYNELDPQVCYKRNIHNRTLEDIEIICTRFFPTP---SHHIQLDPTTLLQSAAITD 105 P I +N++ CYK+ +ED++I P+P S I + L + A T Sbjct: 40 PSIHDHNKIHG--CYKQEKEEEVMEDVDISLQIGLPSPDPNSSVIDFAKSNPLGATATTS 97 Query: 104 VHMEDVQDEVIADDTRETERNSTEPA 27 ++ D+ D E ER E A Sbjct: 98 QELDGDDDD---DHKVEVEREEEEEA 120 >06_01_0469 + 3322886-3323564,3324033-3324953,3325025-3325155, 3325237-3325317,3328173-3328820 Length = 819 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 568 RDKEAEHGGTARIMSIDDYFCKKERLEERDPTTGKTIKKP 449 + K++ GT I + DY+C KE L+ +P T +P Sbjct: 68 KGKQSYFIGTKNIRT-KDYYCSKEGLKYDEPVTEANFNRP 106 >06_01_0209 + 1587656-1587876,1587964-1588055,1590520-1590545, 1591130-1591370,1591459-1591554,1591639-1591754, 1591837-1591917,1592597-1592720,1593222-1593271, 1593735-1593825,1594386-1594421,1594502-1594602, 1594684-1594800 Length = 463 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 ++L GPPG+GK+ LAK + Sbjct: 227 LLLFGPPGNGKTMLAKAV 244 >02_05_0752 + 31491462-31491921,31492177-31492271,31492346-31492573, 31493070-31493157,31493275-31493326,31493985-31494050, 31494382-31494536,31494633-31494703,31494820-31495017, 31495103-31495144,31496223-31496324,31496514-31496603, 31496708-31496783,31497299-31497395,31497488-31497557, 31497676-31497852,31498156-31498239,31498971-31499093, 31500143-31500226,31500318-31500502,31500592-31500730, 31500841-31500900,31500969-31501040,31501136-31501197, 31501839-31501945,31501984-31502058,31502800-31503248 Length = 1168 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 ++L GPPG+GK+ LAK + Sbjct: 722 VLLFGPPGTGKTLLAKAL 739 >02_04_0175 + 20642877-20643618,20643844-20643955,20644052-20644174, 20644258-20644509,20644510-20644639,20644719-20644928, 20645280-20645426 Length = 571 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/58 (24%), Positives = 26/58 (44%) Frame = -1 Query: 562 KEAEHGGTARIMSIDDYFCKKERLEERDPTTGKTIKKPTLKYEFDKDCEESYVNSLKR 389 K + G ++ +DD+ + ER R P + KP D++ + S NS ++ Sbjct: 503 KRPKIGHVIHMLEVDDFPYRDERRGARAPVQARVADKPVAIEAGDRESDSSGNNSARQ 560 >02_01_0137 + 988442-988641,989088-989281,989369-989488,989594-989673, 990244-990510,990840-992458,992571-993327,993560-995506 Length = 1727 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +3 Query: 444 RVGFLIVFPVVGSLSSNLSFLQK*SSIDIILAVPPCSASLSLINLAKYDFP 596 ++ FL++ G +S+L+ + S+ D L PC+ SL L YD P Sbjct: 1302 QIKFLLISQSTGEATSSLASAETTSARDGQLLKMPCNLLRSLKRLCIYDCP 1352 >01_06_1252 - 35748000-35748173,35748243-35748375,35749771-35749847, 35750465-35750509,35750584-35750679,35751125-35751130, 35751259-35751388,35751510-35751706 Length = 285 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 247 SSSLYIRIPGNHSALQSSKYQHNVYGDH*PRRKSEMKSTRRLCFS 381 +S+L + P HS+L S+ Y V G H ++S K T + F+ Sbjct: 234 NSALDWQWPSKHSSLASNFYGTRVVGGHHEYQRSTKKDTTHVNFA 278 >01_05_0749 + 24890944-24891146,24891414-24891535,24891633-24891721, 24891813-24891848,24892268-24892367,24892524-24892566, 24892645-24892739,24892978-24893036,24893114-24893613, 24893691-24893772,24893864-24894429,24894520-24894655, 24894750-24894812,24894942-24895172,24895282-24895395 Length = 812 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -1 Query: 622 IILRGPPGSGKSYLAKLI 569 ++L GPPG+GK+ LAK + Sbjct: 506 VLLFGPPGTGKTMLAKAL 523 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,069,992 Number of Sequences: 37544 Number of extensions: 351180 Number of successful extensions: 1177 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1175 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -