BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40285 (634 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 24 4.6 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 6.1 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 23.8 bits (49), Expect = 4.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 244 GSSSLYIRIPGNHSALQSSKY 306 GSSSLY R+P H+ SS Y Sbjct: 54 GSSSLYDRVPREHAT--SSPY 72 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 6.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 415 PHSLYQTRISEXXXXXXXXXWGLSPLTSPSCR 510 PHSL ++S+ W S L++ SCR Sbjct: 624 PHSLLLAKLSKLGFGDGIISWLSSYLSNRSCR 655 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 675,889 Number of Sequences: 2352 Number of extensions: 13489 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -