BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40284 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27646| Best HMM Match : CbiK (HMM E-Value=2.2) 29 2.8 SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) 28 8.5 >SB_27646| Best HMM Match : CbiK (HMM E-Value=2.2) Length = 423 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 600 WKSIVNIVECVLH*KSWYPPEIRIPVHRSTRMRR 701 WK+I + VE + + K WYP ++ + + R++ R Sbjct: 347 WKTINSAVEYISNEKGWYPYDVSMNIIRNSHYTR 380 >SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) Length = 635 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -2 Query: 443 SRCNCT*DLRTCISGWGAKKKEQD-DSWVTYDE 348 SRCN L CISGW K+ E+ DS DE Sbjct: 192 SRCNHVTGLCRCISGWTGKRCERPCDSGYYGDE 224 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,541,246 Number of Sequences: 59808 Number of extensions: 445651 Number of successful extensions: 762 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -