SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40279
         (388 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   3.9  
AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.          23   5.1  
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    22   6.8  
Y17702-1|CAA76822.2|  260|Anopheles gambiae putative gVAG protei...    22   9.0  
AY645021-1|AAT92557.1|  163|Anopheles gambiae even-skipped protein.    22   9.0  
AF457548-1|AAL68778.1|  178|Anopheles gambiae antigen 5-related ...    22   9.0  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.0 bits (47), Expect = 3.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -2

Query: 159  STGATNGVNRPP 124
            STG++N  NRPP
Sbjct: 1627 STGSSNSCNRPP 1638


>AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 5.1
 Identities = 5/12 (41%), Positives = 8/12 (66%)
 Frame = +1

Query: 106 CCNIWHWGSVDS 141
           CC +W W  ++S
Sbjct: 88  CCRLWRWPDLNS 99


>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
           precursor protein.
          Length = 1623

 Score = 22.2 bits (45), Expect = 6.8
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -2

Query: 345 NRKGPILERCRE 310
           NR GP  ERC+E
Sbjct: 373 NRDGPNCERCKE 384


>Y17702-1|CAA76822.2|  260|Anopheles gambiae putative gVAG protein
           precursor protein.
          Length = 260

 Score = 21.8 bits (44), Expect = 9.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = +3

Query: 246 CHSDCCCHGSPH 281
           C SD C  G PH
Sbjct: 25  CSSDLCPRGGPH 36


>AY645021-1|AAT92557.1|  163|Anopheles gambiae even-skipped protein.
          Length = 163

 Score = 21.8 bits (44), Expect = 9.0
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = -3

Query: 218 SMLVQQRLCFLPLFPLS*NRAREPLMESTDPQCHILQHR 102
           SMLV   +   P  PLS ++++ P  ++     H L H+
Sbjct: 38  SMLVTGSMPPSPYAPLSMSKSQTPPQDTVGTAQHQLHHQ 76


>AF457548-1|AAL68778.1|  178|Anopheles gambiae antigen 5-related 1
           protein protein.
          Length = 178

 Score = 21.8 bits (44), Expect = 9.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = +3

Query: 246 CHSDCCCHGSPH 281
           C SD C  G PH
Sbjct: 25  CSSDLCPRGGPH 36


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 379,533
Number of Sequences: 2352
Number of extensions: 6893
Number of successful extensions: 9
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 29929410
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -