BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40278 (603 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0473 + 8745721-8745994,8746083-8746090,8746232-8746324,874... 34 0.075 04_03_0215 + 12722394-12722581,12722992-12723071,12723315-127235... 29 2.8 09_04_0180 + 15367737-15367755,15368874-15369739 29 3.7 >03_02_0473 + 8745721-8745994,8746083-8746090,8746232-8746324, 8746665-8746893,8747314-8747420,8747560-8747622, 8747883-8747983,8748996-8749090,8749330-8749350, 8749987-8750082,8750188-8750308,8750415-8750570, 8750679-8750869,8751207-8751478,8751853-8751954, 8752006-8752038,8752132-8752308,8752397-8752466, 8752512-8752585,8752667-8752908,8752983-8753129, 8753526-8753751,8753893-8753970,8754378-8754521, 8754829-8755008,8755335-8755394,8755484-8755523, 8758653-8759137 Length = 1294 Score = 34.3 bits (75), Expect = 0.075 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 323 LHDFTPCVDDELEVKRGQIVNVLYRENDWVYVIVAESRREG 445 L+DFT DDEL + G+ V + Y + W YV R+G Sbjct: 1090 LYDFTAGGDDELSLTAGEDVEIEYEVDGWYYVKKKRPGRDG 1130 >04_03_0215 + 12722394-12722581,12722992-12723071,12723315-12723532, 12724084-12724168,12724679-12724725,12725378-12725536 Length = 258 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 549 IVKHLYGLNGWGSTLGSFFFKS*CSHGAQYEC 454 I++H Y +NG STLG FF K GA C Sbjct: 182 IMRHWYFVNGMLSTLGKFFVKG-VEQGAATVC 212 >09_04_0180 + 15367737-15367755,15368874-15369739 Length = 294 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 247 DPVMRPIPGLSPELGLERSLSESPELDFFFFPL 149 DP + P+P L PE +E L EL+ P+ Sbjct: 49 DPALEPLPDLDPEPEVEAELEAELELELLVPPI 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,663,730 Number of Sequences: 37544 Number of extensions: 341686 Number of successful extensions: 747 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -