BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40276 (632 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0529 - 21788132-21788395,21788414-21788511,21789458-217899... 54 7e-08 02_02_0095 + 6716327-6716335,6717302-6717451,6717523-6717583,671... 52 3e-07 01_01_1176 - 9372879-9373097,9373814-9374278,9374372-9375447,937... 44 1e-04 10_06_0131 - 11066033-11066251,11066548-11067012,11067102-110681... 40 0.002 02_05_1202 + 34932291-34933027,34933297-34933774 35 0.062 07_01_0377 + 2823602-2823880,2824372-2824569,2824611-2824709 31 1.0 07_03_0346 - 17010472-17010843 30 1.8 06_01_0611 + 4420873-4422207 30 1.8 10_08_0313 - 16677849-16679060,16679158-16679244,16679749-16680111 29 4.1 08_02_0792 + 21233578-21233710,21233807-21233936,21234097-21234766 29 4.1 03_03_0142 + 14800317-14801240 29 4.1 03_06_0642 + 35239658-35240083,35240167-35240238,35240305-352409... 28 7.1 07_03_1363 - 26022333-26023225,26023319-26023451 27 9.4 01_07_0080 - 40955222-40955676,40956123-40956171,40956282-40956443 27 9.4 >06_03_0529 - 21788132-21788395,21788414-21788511,21789458-21789953, 21790033-21790134,21790218-21790270,21790354-21790414, 21790491-21790640,21791298-21791350,21794125-21794152 Length = 434 Score = 54.4 bits (125), Expect = 7e-08 Identities = 27/77 (35%), Positives = 44/77 (57%) Frame = +1 Query: 4 ERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTLLHAFQHVLDPSVRSSLINVQ 183 E A + L +L L+ HL + T+LV +TLAD+++ L + F +L S S +V+ Sbjct: 152 EFAITSLKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYYGFVRILIKSFTSEFPHVE 211 Query: 184 RWFLTVAHQPQVSAVVG 234 R+F T+ +QP V+G Sbjct: 212 RYFWTMVNQPNFKKVIG 228 Score = 43.6 bits (98), Expect = 1e-04 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +2 Query: 512 FWEKFDPENYSIWYAEYKYPEELAKVFMSCN 604 FW+ +DPE YS+W+ +YKY +E F++ N Sbjct: 316 FWDMYDPEGYSLWFCDYKYNDENTVSFVTMN 346 >02_02_0095 + 6716327-6716335,6717302-6717451,6717523-6717583, 6717646-6717725,6717802-6717903,6717982-6718471, 6718796-6719171,6720320-6720379,6720887-6721056, 6721287-6721340,6721384-6721523,6722362-6722511, 6722582-6722642,6722705-6722784,6722933-6723034, 6723111-6723612,6724401-6724776,6725419-6725493, 6726058-6726198,6726264-6726282 Length = 1065 Score = 52.4 bits (120), Expect = 3e-07 Identities = 26/77 (33%), Positives = 43/77 (55%) Frame = +1 Query: 4 ERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTLLHAFQHVLDPSVRSSLINVQ 183 E A + L +L L+ HL + T+LV +TLAD+++ L F ++ S S +V+ Sbjct: 137 EAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFARIMTKSFTSEFPHVE 196 Query: 184 RWFLTVAHQPQVSAVVG 234 R+F T+ +QP V+G Sbjct: 197 RYFWTMVNQPNFKKVLG 213 Score = 51.2 bits (117), Expect = 7e-07 Identities = 25/77 (32%), Positives = 43/77 (55%) Frame = +1 Query: 4 ERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTLLHAFQHVLDPSVRSSLINVQ 183 E A + L +L L+ HL + T+LV +TLAD+++ L F ++ + S +V+ Sbjct: 698 EAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFARIMTKNFTSEFPHVE 757 Query: 184 RWFLTVAHQPQVSAVVG 234 R+F T+ +QP V+G Sbjct: 758 RYFWTMVNQPNFKKVMG 774 Score = 46.8 bits (106), Expect = 1e-05 Identities = 15/37 (40%), Positives = 26/37 (70%) Frame = +2 Query: 512 FWEKFDPENYSIWYAEYKYPEELAKVFMSCNLIYGYV 622 FW+ +DPE YS+W+ +YKY +E F++ N + G++ Sbjct: 299 FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFL 335 Score = 46.8 bits (106), Expect = 1e-05 Identities = 15/37 (40%), Positives = 26/37 (70%) Frame = +2 Query: 512 FWEKFDPENYSIWYAEYKYPEELAKVFMSCNLIYGYV 622 FW+ +DPE YS+W+ +YKY +E F++ N + G++ Sbjct: 864 FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFL 900 >01_01_1176 - 9372879-9373097,9373814-9374278,9374372-9375447, 9375534-9375687,9375783-9375879,9376238-9376374 Length = 715 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/63 (36%), Positives = 36/63 (57%) Frame = +1 Query: 16 SDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTLLHAFQHVLDPSVRSSLINVQRWFL 195 S+ AA LDG+L +RTFLV+ +++AD++V+S L Q N+ RWF Sbjct: 93 SEFEAACSFLDGYLASRTFLVSYGLSIADIVVWSNLAGTGQRWESLRRSKKYQNLVRWFN 152 Query: 196 TVA 204 ++A Sbjct: 153 SIA 155 >10_06_0131 - 11066033-11066251,11066548-11067012,11067102-11068177, 11068269-11068422,11068511-11068601,11069016-11069152 Length = 713 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/59 (35%), Positives = 31/59 (52%) Frame = +1 Query: 16 SDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTLLHAFQHVLDPSVRSSLINVQRWF 192 S+ A +DG+L++RTFLV +T+AD+ V+S L Q N+ RWF Sbjct: 91 SEFEVACSFVDGYLMSRTFLVGHVLTIADITVWSNLAGIGQRWESLRKSKKYQNLVRWF 149 >02_05_1202 + 34932291-34933027,34933297-34933774 Length = 404 Score = 34.7 bits (76), Expect = 0.062 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +1 Query: 4 ERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTLL 126 + A +L AAL L+ HL +L + +TLADV +F+TL+ Sbjct: 257 DAAAGELFAALDRLEDHLSGSRYLCGDTLTLADVCLFTTLV 297 >07_01_0377 + 2823602-2823880,2824372-2824569,2824611-2824709 Length = 191 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = +1 Query: 4 ERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIV--FSTLLHAF-QHV 144 E AK++LL L+ L+G L R+F + D+++ FS++ H + QH+ Sbjct: 110 EMAKAELLDQLRRLEGVLGDRSFFSGDEFGFLDIVLIPFSSMFHGYKQHM 159 >07_03_0346 - 17010472-17010843 Length = 123 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 204 PPATSVGRRRLAHALCGPPTYDPKKYQELAGA 299 P AT V R A G P DP +Y+ LAGA Sbjct: 6 PTATPVDTRAKLSASDGTPVKDPTEYRSLAGA 37 >06_01_0611 + 4420873-4422207 Length = 444 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = +3 Query: 162 FVADKRSAL-----VPDRRPPATSVGRRRLAHALC 251 +V D+ +AL P RRPPA S RRRLA + C Sbjct: 279 YVMDEHAALRVAVRTPKRRPPARSRSRRRLALSEC 313 >10_08_0313 - 16677849-16679060,16679158-16679244,16679749-16680111 Length = 553 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 Query: 59 SHAPSLLPRESHLPMSLSS 115 +H PSL+P ESHL S+SS Sbjct: 498 NHQPSLVPNESHLNNSVSS 516 >08_02_0792 + 21233578-21233710,21233807-21233936,21234097-21234766 Length = 310 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = -3 Query: 438 ASSRRGPWTP*AFQAPPLQGQEQLPPSSWVALSFHTSYLFCPPSCSV---HQLTPG 280 A ++GPWTP QE P +W A+ +T + C SC + + L PG Sbjct: 10 AEVKKGPWTPEEDLMLVAYVQEH-GPGNWRAVPTNTGLMRCSKSCRLRWTNYLRPG 64 >03_03_0142 + 14800317-14801240 Length = 307 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -3 Query: 429 RRGPWTP*AFQAPPLQGQEQLPPSSWVALSFHTSYLFCPPSCSV---HQLTPG 280 ++GPWTP QE P +W A+ T L C SC + + L PG Sbjct: 13 KKGPWTPEEDMVLASYVQEH-GPGNWRAVPPRTGLLRCSKSCRLRWTNYLRPG 64 >03_06_0642 + 35239658-35240083,35240167-35240238,35240305-35240919, 35241253-35241435,35241604-35241663,35241733-35241936, 35242497-35242745,35243609-35243707,35243760-35243858, 35244463-35244480,35244668-35244862,35244981-35245073, 35245265-35245531,35245884-35246102 Length = 932 Score = 27.9 bits (59), Expect = 7.1 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = +3 Query: 138 ARAR-PERPFVADKRSA---LVPDRRPPATSVGRRR 233 +RAR P PF + RS+ PDRRPP T R R Sbjct: 28 SRARTPRAPFPSTSRSSNPYSFPDRRPPPTPRSRSR 63 >07_03_1363 - 26022333-26023225,26023319-26023451 Length = 341 Score = 27.5 bits (58), Expect = 9.4 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -3 Query: 429 RRGPWTP*AFQAPPLQGQEQLPPSSWVALSFHTSYLFCPPSCSV---HQLTPG 280 ++GPWTP QE P +W A+ T + C SC + + L PG Sbjct: 13 KKGPWTPEEDLVLVSYVQEH-GPGNWRAVPTRTGLMRCSKSCRLRWTNYLRPG 64 >01_07_0080 - 40955222-40955676,40956123-40956171,40956282-40956443 Length = 221 Score = 27.5 bits (58), Expect = 9.4 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = +1 Query: 1 VERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTLLHAFQHVLDPSVRSSLINV 180 V+ + L L V D HL +L R +LAD S LL + + V +S +V Sbjct: 137 VDEHAAALAQVLDVYDAHLAGSRYLAGNRFSLADANHMSYLLFLSKTPMAELV-ASRPHV 195 Query: 181 QRWFLTVAHQP 213 + W+ ++ +P Sbjct: 196 KAWWDDISSRP 206 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,278,924 Number of Sequences: 37544 Number of extensions: 347794 Number of successful extensions: 1048 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1047 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -