BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40275 (610 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 6.1 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 8.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 8.1 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 83 DNLQYQFFPVSSGSVQFKVRAAND 154 DNLQY F SG++ + + D Sbjct: 201 DNLQYSFDNQCSGTIDWALPKQED 224 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +1 Query: 388 WSDPEPFPVYYVGVCTSWGATSSLKIEVPP 477 + DP P+ Y +WG+ + +E+ P Sbjct: 245 YGDPIPYIQYTETETKTWGSVFNTVLELMP 274 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 8.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 382 ISWSDPEPFPVYYV 423 + WS P+ P YY+ Sbjct: 292 LMWSKPDLIPNYYI 305 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,085 Number of Sequences: 336 Number of extensions: 3428 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -