BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40275 (610 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280612-1|AAQ21365.1| 309|Anopheles gambiae carbonic anhydrase... 26 1.1 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 2.5 EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. 24 3.3 EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. 24 3.3 EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. 24 3.3 EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. 24 3.3 EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. 24 3.3 EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. 24 3.3 EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. 24 3.3 EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. 24 3.3 EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. 24 3.3 EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. 24 3.3 EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. 24 3.3 EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. 24 3.3 EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. 24 3.3 EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. 24 3.3 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 5.8 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 5.8 EF426175-1|ABO26418.1| 155|Anopheles gambiae unknown protein. 23 7.7 >AY280612-1|AAQ21365.1| 309|Anopheles gambiae carbonic anhydrase protein. Length = 309 Score = 25.8 bits (54), Expect = 1.1 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -2 Query: 513 LPRNKASCYRCSRWHFDFQGACGTPACADSDVVNWERF 400 LP N+ S YR ++G+ TPACA+S V W F Sbjct: 202 LPSNRTSFYR-------YEGSLTTPACAES--VIWTVF 230 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.6 bits (51), Expect = 2.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 516 PWLTLGGLTEGKRTPSGLGGLPEG 587 P+ ++ GL G P GLG P+G Sbjct: 549 PFFSIPGLPPGLSAPLGLGMRPQG 572 >EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. Length = 163 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 134 EPFCVYIQGSTMSWVATS 151 >EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 137 EPFCVYIQGSTMSWVATS 154 >EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 137 EPFCVYIQGSTMSWVATS 154 >EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 132 EPFCVYIQGSTMSWVATS 149 >EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. Length = 176 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 147 EPFCVYIQGSTMSWVATS 164 >EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 142 EPFCVYIQGSTMSWVATS 159 >EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 142 EPFCVYIQGSTMSWVATS 159 >EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 142 EPFCVYIQGSTMSWVATS 159 >EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 148 EPFCVYIQGSTMSWVATS 165 >EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. Length = 164 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 135 EPFCVYIQGSTMSWVATS 152 >EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 136 EPFCVYIQGSTMSWVATS 153 >EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. Length = 152 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 123 EPFCVYIQGSTMSWVATS 140 >EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 132 EPFCVYIQGSTMSWVATS 149 >EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 400 EPFPVYYVGVCTSWGATS 453 EPF VY G SW ATS Sbjct: 136 EPFCVYIQGSTMSWVATS 153 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 536 ANGRKTYPLRSWRATGGKRNPSGF 607 A G K R WR GGK++ S + Sbjct: 237 AAGGKEEETRQWRKEGGKQSKSRY 260 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.4 bits (48), Expect = 5.8 Identities = 15/59 (25%), Positives = 24/59 (40%) Frame = +2 Query: 47 TIMANVMDVATDDNLQYQFFPVSSGSVQFKVRAANDAHIALTTGPQESDPMYEVMIGGW 223 T A V TD+N+QY + + F V +ND I+ +++ P W Sbjct: 473 TFSARVGRGLTDENMQYMYRKAYRDKLSFSV--SNDQMISFAQFCKDTTPECNYTFWEW 529 >EF426175-1|ABO26418.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.0 bits (47), Expect = 7.7 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 405 FPSLLRRSLHKLGCHKLLENRSATDCTCS--SLLCYAAT 515 F +LL +S+ L C++ S +DC S S+ C +A+ Sbjct: 16 FGALLAQSVSALRCYQCASPSSWSDCQASAQSVECTSAS 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 638,016 Number of Sequences: 2352 Number of extensions: 14439 Number of successful extensions: 136 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -