BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40273 (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 24 5.1 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 23 9.0 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 23.8 bits (49), Expect = 5.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 266 LPGVEPTYCQQFE*YTIRMSEFRDELWQSG 355 L G+ Q+ E Y R SEF E W SG Sbjct: 412 LVGMGQLVLQREEGYFTRPSEFMPERWLSG 441 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 40 ICIFPMLSQHLKLTY 84 +C FPMLS LTY Sbjct: 370 VCWFPMLSSRRLLTY 384 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 724,395 Number of Sequences: 2352 Number of extensions: 14297 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -