BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40273 (684 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC016018-1|AAH16018.1| 278|Homo sapiens ACMSD protein protein. 30 6.7 AC016725-1|AAY14997.1| 278|Homo sapiens unknown protein. 30 6.7 >BC016018-1|AAH16018.1| 278|Homo sapiens ACMSD protein protein. Length = 278 Score = 30.3 bits (65), Expect = 6.7 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 228 IQAFRLVNWPNTSK*Q*TLKLCTQLNNTLKVSVI 127 IQ F L W +K + TL LC LNN L +V+ Sbjct: 14 IQKFVLEKWTKKAKPEDTLNLCQLLNNDLASTVV 47 >AC016725-1|AAY14997.1| 278|Homo sapiens unknown protein. Length = 278 Score = 30.3 bits (65), Expect = 6.7 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 228 IQAFRLVNWPNTSK*Q*TLKLCTQLNNTLKVSVI 127 IQ F L W +K + TL LC LNN L +V+ Sbjct: 14 IQKFVLEKWTKKAKPEDTLNLCQLLNNDLASTVV 47 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,260,082 Number of Sequences: 237096 Number of extensions: 2132632 Number of successful extensions: 2371 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2371 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -