BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40269 (672 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0045 - 7705728-7707581 29 2.6 12_02_1131 - 26358339-26360609 29 4.5 >11_02_0045 - 7705728-7707581 Length = 617 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 64 FYVSRSRNINLRYLLSYTSLIGEVSCSFNVF 156 F V++S N N+RY + Y+ VSCS + F Sbjct: 488 FEVTQSENANIRYTVLYSEPRASVSCSCHKF 518 >12_02_1131 - 26358339-26360609 Length = 756 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Frame = +1 Query: 46 CFC*KSFYVSRSRNINLRYLLSYTSLIGEVSCSFNVFTARCPKYK-FSTRIVELLPLI-S 219 C C Y+S R++++ L Y++ E+ C + +A P+ F E+ PL+ + Sbjct: 269 CLCVYPAYLSSERSLDIWLLTDYSTATWELRCRIDPTSATSPETNDFFLVNREVTPLVLT 328 Query: 220 VTHSTFLILRE 252 H L+L E Sbjct: 329 DDHRRVLLLSE 339 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,142,885 Number of Sequences: 37544 Number of extensions: 264357 Number of successful extensions: 406 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 406 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -