BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40267 (609 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 25 0.50 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 25 0.66 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 25.0 bits (52), Expect = 0.50 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -1 Query: 195 PNHFSTFRRRGFTMRMSTAKCLKFLL 118 PN ++ F + +T + KC+K+L+ Sbjct: 33 PNFYNDFEVQRYTWKCENQKCVKYLV 58 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 24.6 bits (51), Expect = 0.66 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -2 Query: 599 LFNVFICHLAQQLFSQIHKDHPRTF*YPYSYCSRLLNESSRARDIFQ 459 LFN F L S +H + + Y Y R +ES + R++ + Sbjct: 265 LFNTFGTILLIMTCSGVHSESQKLVGVCYEYQDRFSDESKKRRELLR 311 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,853 Number of Sequences: 336 Number of extensions: 3077 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -