BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40267 (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 7.7 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 7.7 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.0 bits (47), Expect = 7.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 343 LRYVTSWVRNTSEG 384 +RY+ SWV N + G Sbjct: 84 VRYINSWVHNQTHG 97 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.0 bits (47), Expect = 7.7 Identities = 12/51 (23%), Positives = 22/51 (43%) Frame = -3 Query: 238 HVNRLSSRRHLLFGSEPFLNLQETRVYHANVNSQVFEVPFENSAGPFNCHQ 86 H + HL+ G E Q++++ H++ + + ENS N Q Sbjct: 602 HGDGTDGSNHLMAGKESISQHQQSQLQHSHQAQSLDQQSQENSNSVANSEQ 652 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,755 Number of Sequences: 2352 Number of extensions: 14261 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -