BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40264 (647 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 29 0.13 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 8.3 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 29.1 bits (62), Expect = 0.13 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 298 PALSNPIPDSVGAYPPAKPFTPPGVYPHPE 387 P+L+ +P SV PPA+P PP PE Sbjct: 88 PSLAPVVPSSVVTAPPARPSQPPTTRFAPE 117 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 289 FVAPALSNPIPDSVGAYPPA 348 F APAL+ P V + PPA Sbjct: 47 FAAPALTQAAPAPVVSQPPA 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 627,322 Number of Sequences: 2352 Number of extensions: 12407 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -