BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40264 (647 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032627-8|CAB63354.2| 373|Caenorhabditis elegans Hypothetical ... 28 5.0 Z82051-10|CAB04822.2| 577|Caenorhabditis elegans Hypothetical p... 27 8.7 AL021175-11|CAA15973.2| 577|Caenorhabditis elegans Hypothetical... 27 8.7 >AL032627-8|CAB63354.2| 373|Caenorhabditis elegans Hypothetical protein Y41C4A.5 protein. Length = 373 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 298 PALSNPIPDSVGAYPPAKPFTPPGVYPHP 384 P P+P G YPP P+ PPG YP+P Sbjct: 287 PQYPYPVPPH-GYYPPGYPY-PPG-YPYP 312 >Z82051-10|CAB04822.2| 577|Caenorhabditis elegans Hypothetical protein T23D5.2 protein. Length = 577 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = +2 Query: 506 FNCNKIVTTRVTYTTAWHTHLIAGS----ICLITIVC-SLCCLGLIPYCLIH 646 F C + + Y TA+H I G+ I L +++C S CL ++ + +H Sbjct: 22 FVCTCLFNAILIYLTAFHVEKITGAYKHLIILFSLICMSFSCLEVLAHPYLH 73 >AL021175-11|CAA15973.2| 577|Caenorhabditis elegans Hypothetical protein T23D5.2 protein. Length = 577 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = +2 Query: 506 FNCNKIVTTRVTYTTAWHTHLIAGS----ICLITIVC-SLCCLGLIPYCLIH 646 F C + + Y TA+H I G+ I L +++C S CL ++ + +H Sbjct: 22 FVCTCLFNAILIYLTAFHVEKITGAYKHLIILFSLICMSFSCLEVLAHPYLH 73 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,580,282 Number of Sequences: 27780 Number of extensions: 264675 Number of successful extensions: 701 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -