BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40261 (513 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0WWS3 Cluster: Putative uncharacterized protein; n=1; ... 35 1.2 UniRef50_UPI0000D566B0 Cluster: PREDICTED: hypothetical protein;... 32 8.8 UniRef50_Q1NS85 Cluster: Sensor protein; n=2; delta proteobacter... 32 8.8 >UniRef50_Q0WWS3 Cluster: Putative uncharacterized protein; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein - Arabidopsis thaliana (Mouse-ear cress) Length = 80 Score = 34.7 bits (76), Expect = 1.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +3 Query: 21 MKNAVNCAS*CELQDTFEHRHFERTLR 101 MKN C + CELQ+ HR FER LR Sbjct: 1 MKNVAKCDTWCELQNPVNHRVFERKLR 27 >UniRef50_UPI0000D566B0 Cluster: PREDICTED: hypothetical protein; n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical protein - Tribolium castaneum Length = 243 Score = 31.9 bits (69), Expect = 8.8 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -3 Query: 148 CSRPSDRSGPGCVSTDRNVRSKCRCSNVSCSSHYDAQLTAFFIDP 14 C P +GPG S V +K C+N SC+++Y+ + T F P Sbjct: 83 CEAPLVCNGPGKYSV---VPTKTDCNNDSCNNYYECEATWFLFVP 124 >UniRef50_Q1NS85 Cluster: Sensor protein; n=2; delta proteobacterium MLMS-1|Rep: Sensor protein - delta proteobacterium MLMS-1 Length = 537 Score = 31.9 bits (69), Expect = 8.8 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +3 Query: 69 FEHRHFERTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 203 F+HR + ++R VE GP+L EGR H V+ A V R + Sbjct: 212 FQHRRADGSIREVEVFAGPILLEGRSLLYSIVHDVSERARVEREL 256 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,570,127 Number of Sequences: 1657284 Number of extensions: 7675741 Number of successful extensions: 18492 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18486 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31364627325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -