BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40261 (513 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 26 2.9 SPAC1B2.05 |mcm5|nda4, SPAC3F10.01|MCM complex subunit Mcm5|Schi... 26 3.8 SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||M... 25 5.0 SPCC126.06 |twf1||twinfilin|Schizosaccharomyces pombe|chr 3|||Ma... 25 5.0 SPAC12G12.11c |||DUF544 family protein|Schizosaccharomyces pombe... 25 8.8 SPBC1289.04c |pob1||Boi family protein|Schizosaccharomyces pombe... 25 8.8 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 26.2 bits (55), Expect = 2.9 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +1 Query: 58 CRTHLNIDISNAHCGPWRHIQDHSCLRAGC---IKNINHIAWLVP 183 C +N S CG H+ SC+R C I+ N AW P Sbjct: 200 CTDTINPSTSIWSCGTCYHVFHLSCIRKWCKNSIEQRNEDAWRCP 244 >SPAC1B2.05 |mcm5|nda4, SPAC3F10.01|MCM complex subunit Mcm5|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.8 bits (54), Expect = 3.8 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 470 RLIQRQQQNNE-TKTTKIHIHENSTRTLNITRAPERFDVI 354 R++ Q +N+ +K+T + E L I+R P +D+I Sbjct: 287 RVVGIQMDSNDGSKSTPLFSEEEEEEFLEISRTPNLYDII 326 >SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 25.4 bits (53), Expect = 5.0 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 267 PKTTITNRVSLARLSDGSKNVLLLFQNFHNHVEP 368 PKT +T +S + S S +L QNF+N P Sbjct: 577 PKTNLTRSLSYSEQSFDSGVSILSCQNFYNIFHP 610 >SPCC126.06 |twf1||twinfilin|Schizosaccharomyces pombe|chr 3|||Manual Length = 328 Score = 25.4 bits (53), Expect = 5.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 60 QDTFEHRHFERTLRSVETHPGPLLSEG 140 QD E + + +++S TH PL++ G Sbjct: 147 QDELERKEYNESMQSSVTHKRPLVTRG 173 >SPAC12G12.11c |||DUF544 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 365 Score = 24.6 bits (51), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 455 QQQNNETKTTKIHIHENSTRTLNI 384 Q+ NNET+ K H NS +T I Sbjct: 12 QEHNNETQNHKQEDHSNSYQTRTI 35 >SPBC1289.04c |pob1||Boi family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 871 Score = 24.6 bits (51), Expect = 8.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 449 QNNETKTTKIHIHENSTRTLNITRAPERFDVIMKI 345 +N T + + N + LNIT +RF+V+ KI Sbjct: 273 ENEITGEILLGLDSNVLKELNITSFGKRFEVLRKI 307 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,819,655 Number of Sequences: 5004 Number of extensions: 31939 Number of successful extensions: 78 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 206265012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -