BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40258 (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.56 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.56 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.56 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.56 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 24 0.98 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 24 0.98 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 24 0.98 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 1.7 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 1.7 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 1.7 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 2.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.1 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.56 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 288 RHRYRWNLVMYM 323 RHR RW+ VMYM Sbjct: 693 RHRKRWSQVMYM 704 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.56 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 288 RHRYRWNLVMYM 323 RHR RW+ VMYM Sbjct: 693 RHRKRWSQVMYM 704 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.56 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 288 RHRYRWNLVMYM 323 RHR RW+ VMYM Sbjct: 693 RHRKRWSQVMYM 704 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.56 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 288 RHRYRWNLVMYM 323 RHR RW+ VMYM Sbjct: 693 RHRKRWSQVMYM 704 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 24.2 bits (50), Expect = 0.98 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = +1 Query: 133 SNTDNEHDAPNGEGKIVKTEEKSDCSDTNKK 225 +N+D + D +G+G +E D +T + Sbjct: 178 ANSDEQDDGDDGQGSSTNNDEDDDDEETGDR 208 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 24.2 bits (50), Expect = 0.98 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = +1 Query: 133 SNTDNEHDAPNGEGKIVKTEEKSDCSDTNKK 225 +N+D + D +G+G +E D +T + Sbjct: 178 ANSDEQDDGDDGQGSSTNNDEDDDDEETGDR 208 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 24.2 bits (50), Expect = 0.98 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = +1 Query: 133 SNTDNEHDAPNGEGKIVKTEEKSDCSDTNKK 225 +N+D + D +G+G +E D +T + Sbjct: 178 ANSDEQDDGDDGQGSSTNNDEDDDDEETGDR 208 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.4 bits (48), Expect = 1.7 Identities = 9/32 (28%), Positives = 13/32 (40%) Frame = -1 Query: 485 CRDRDSIEICLNHLIRALPLQSSLVCSLCVPS 390 CR+ + IC H L C +C P+ Sbjct: 112 CREGEPPRICYYHFTLELYTVLGAACQVCTPN 143 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.4 bits (48), Expect = 1.7 Identities = 9/32 (28%), Positives = 13/32 (40%) Frame = -1 Query: 485 CRDRDSIEICLNHLIRALPLQSSLVCSLCVPS 390 CR+ + IC H L C +C P+ Sbjct: 112 CREGEPPRICYYHFTLELYTVLGAACQVCTPN 143 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 1.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 306 NLVMYMPDIHVIFNIEFISFLYFLYY 383 +L+ Y P +IF + F+ Y+ YY Sbjct: 82 HLLFYCP--FIIFTVHFLLCTYYFYY 105 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 343 SILNSFPFYIFYIIQIDGTHKEQTRE 420 S LN+F F IF + + HK T E Sbjct: 292 SFLNNFYFIIFQVFESFYLHKATTLE 317 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 Query: 284 HTAPISLESGHVYARYTCNF 343 H AP+ G VY + NF Sbjct: 2525 HVAPLYYYPGDVYDYFNANF 2544 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,520 Number of Sequences: 336 Number of extensions: 3789 Number of successful extensions: 13 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -