BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40258 (668 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-2636|AAO41247.1| 884|Drosophila melanogaster CG5215-PB... 46 4e-05 >AE014296-2636|AAO41247.1| 884|Drosophila melanogaster CG5215-PB, isoform B protein. Length = 884 Score = 46.4 bits (105), Expect = 4e-05 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 3 LTASAQQFLRQIAFRQIHKVLDMEPLPKANMRRAP 107 LT SAQ FLR IAFRQI+KVL MEPLP P Sbjct: 801 LTVSAQLFLRYIAFRQIYKVLGMEPLPAMKFPMRP 835 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,562,314 Number of Sequences: 53049 Number of extensions: 656227 Number of successful extensions: 1679 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1679 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2889369000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -