BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40256 (626 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 25 0.80 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 4.3 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 24.6 bits (51), Expect = 0.80 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +1 Query: 430 VSNCLDKFDATHPP*MSNNIIQHWHSIIHSLRTHSKLAYCGRYDHVGFRQRFWKFRLVLC 609 V +CL ++ P + + W SI+ S T + YDH+ + R + Sbjct: 426 VKDCLISWNPLMQPKQPIKLFEQWKSILESGTTTLQTRTMHPYDHLVWNSWMPSIRGAIQ 485 Query: 610 HW 615 W Sbjct: 486 QW 487 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 337 ITQYIWTFHHYPWS 378 +TQ IWT HH W+ Sbjct: 58 VTQ-IWTDHHLKWN 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,218 Number of Sequences: 438 Number of extensions: 3792 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -