BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40255 (622 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) 30 1.7 SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) 29 3.0 SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) 28 5.3 SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 55.6 bits (128), Expect = 3e-08 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%) Frame = +1 Query: 10 SVKVHPVVLFQIVDAYERRN--ADSHRVIGTLLGTSDKGVVEVTNCFCVPHKE-HADQVE 180 +V VHP+VL +VD + R RV+G LLG+ KGV++V NCF VP E DQ Sbjct: 10 TVVVHPIVLLSVVDHFNRMGKVGSQKRVVGVLLGSRRKGVLDVANCFAVPFDEDDRDQNV 69 Query: 181 --AELNYAMDVYELNRRVN 231 + +Y ++Y + ++VN Sbjct: 70 WFLDHDYLENMYAMFKKVN 88 >SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 43.6 bits (98), Expect = 1e-04 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = +1 Query: 13 VKVHPVVLFQIVDAYERRNADSHRVIGTLLGTSDKGVVEVTNCFCVP-HKEHADQVEAEL 189 V+V + + +I+ E + V G LLG +E+TNCF P +K D+ + ++ Sbjct: 18 VQVDGLTVLKIIKHCEEEGSSGDLVQGVLLGLIQDNRLEITNCFPFPSNKAGDDEDDDDV 77 Query: 190 NYAMDVYELNRRVNSSESIVG 252 NY M+V R VN VG Sbjct: 78 NYQMEVMRRLRAVNIDHLHVG 98 >SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/44 (36%), Positives = 27/44 (61%) Frame = +1 Query: 175 VEAELNYAMDVYELNRRVNSSESIVGCGRLAMK*PTTPLLYTSI 306 V EL YA +YEL+++ N +E IVGC ++ + T +++ I Sbjct: 1 VAVELEYAKSMYELSQKANPNEQIVGCVKMGVPGKTEGTMFSQI 44 Score = 35.5 bits (78), Expect = 0.035 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 390 CVPLGVPNGKQGCMFTPVDVTLTCYEPEIVGLQVCQKTVS 509 CV +GVP +G MF+ + + PE VG+ V Q+T S Sbjct: 27 CVKMGVPGKTEGTMFSQIPCEVKLTGPEKVGVDVLQRTKS 66 >SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) Length = 419 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 6 Y*CKGPSCCFISNCGRIRTSKCRF 77 Y C+G + CFI R R KCRF Sbjct: 76 YTCRGSNDCFIDKVHRNRCQKCRF 99 >SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) Length = 219 Score = 29.1 bits (62), Expect = 3.0 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = -1 Query: 244 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 65 Y+ + CS + PSR +P R R + +R+ W++ +CR P R L ++F Sbjct: 36 YYNYRHVRCSRSREPSR--IPKRFLRRIHNKSRKLRWVVYHRICRKIP-RSSNLHNYINF 92 Query: 64 DVRMRPQFEIK 32 R F+ K Sbjct: 93 GRLRRRYFDSK 103 >SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 28.3 bits (60), Expect = 5.3 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -1 Query: 244 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 65 Y+ + CS + PSR +P R R + +R+ W++ +CR+ P R L ++F Sbjct: 90 YYNYRHVRCSRSREPSR--IPKRFLRRLHNKSRKLRWVVYHRICRNIP-RSSNLHNYINF 146 Query: 64 D-VRMRP 47 +R RP Sbjct: 147 GRLRRRP 153 >SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) Length = 270 Score = 28.3 bits (60), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 338 YSGHFTGWRSNGFTCICL 391 ++GH W SNG TC+ L Sbjct: 201 FNGHTYSWHSNGVTCVLL 218 >SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 329 CPCYSGHFTGWRSNGFTCIC 388 CPC +G + +GFTCIC Sbjct: 130 CPCKNGGHCVNKVDGFTCIC 149 >SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 329 CPCYSGHFTGWRSNGFTCIC 388 CPC +G + +GFTCIC Sbjct: 130 CPCKNGGHCVNKVDGFTCIC 149 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,010,257 Number of Sequences: 59808 Number of extensions: 452180 Number of successful extensions: 1638 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1636 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -