BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40254 (688 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1480 - 37660591-37660720,37660899-37660930,37661061-376611... 28 6.0 >01_06_1480 - 37660591-37660720,37660899-37660930,37661061-37661155, 37661460-37661527,37661608-37661694,37662884-37662912, 37663019-37663138,37663854-37663905,37663986-37664050, 37664174-37664536,37664637-37664711,37664803-37664940, 37665025-37665181,37665471-37665478,37665576-37665710, 37665965-37666082,37666791-37666915,37667571-37667717, 37668297-37668380,37668671-37668800,37669196-37669347, 37669678-37669857,37670660-37670731,37671104-37671295, 37671366-37671411,37671498-37671647,37671725-37671882, 37671995-37672101,37672191-37672407,37672484-37672696, 37672852-37672972,37673072-37673253,37673475-37673672, 37674770-37674967 Length = 1447 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = -2 Query: 678 FEYFNLIHIKIS*ILF---RKVQLEV*EKISFTRK*REPNYKPTLRCSTTLRNIYEKHLE 508 F YF HIK I+F R++QLE+ +S K EP+ + + + RN+ + Sbjct: 495 FSYFKPQHIKALHIIFSLKRRLQLEMQAYLSLRAKKEEPSDEIQKKFCASFRNMSVAFAD 554 Query: 507 *TNV 496 +NV Sbjct: 555 ASNV 558 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,599,542 Number of Sequences: 37544 Number of extensions: 215936 Number of successful extensions: 376 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -