BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40254 (688 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF152242-1|AAD46774.1| 2156|Homo sapiens retinitis pigmentosa 1 ... 30 6.7 AF146592-1|AAD46769.1| 2156|Homo sapiens retinitis pigmentosa 1 ... 30 6.7 AF143226-1|AAD44197.1| 2156|Homo sapiens retinitis pigmentosa RP... 30 6.7 AF141021-1|AAD42072.1| 2156|Homo sapiens oxygen-regulated protei... 30 6.7 AK096901-1|BAC04889.1| 127|Homo sapiens protein ( Homo sapiens ... 30 8.9 >AF152242-1|AAD46774.1| 2156|Homo sapiens retinitis pigmentosa 1 protein protein. Length = 2156 Score = 30.3 bits (65), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 372 CVPCILCHKDRSYSPYTYCIIVSTFICCDSY 280 C PC +C +++YSP C TF D Y Sbjct: 1256 CSPCEMCTVNKAYSPKETCNPSDTFFPSDGY 1286 >AF146592-1|AAD46769.1| 2156|Homo sapiens retinitis pigmentosa 1 protein protein. Length = 2156 Score = 30.3 bits (65), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 372 CVPCILCHKDRSYSPYTYCIIVSTFICCDSY 280 C PC +C +++YSP C TF D Y Sbjct: 1256 CSPCEMCTVNKAYSPKETCNPSDTFFPSDGY 1286 >AF143226-1|AAD44197.1| 2156|Homo sapiens retinitis pigmentosa RP1 protein protein. Length = 2156 Score = 30.3 bits (65), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 372 CVPCILCHKDRSYSPYTYCIIVSTFICCDSY 280 C PC +C +++YSP C TF D Y Sbjct: 1256 CSPCEMCTVNKAYSPKETCNPSDTFFPSDGY 1286 >AF141021-1|AAD42072.1| 2156|Homo sapiens oxygen-regulated protein 1 protein. Length = 2156 Score = 30.3 bits (65), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 372 CVPCILCHKDRSYSPYTYCIIVSTFICCDSY 280 C PC +C +++YSP C TF D Y Sbjct: 1256 CSPCEMCTVNKAYSPKETCNPSDTFFPSDGY 1286 >AK096901-1|BAC04889.1| 127|Homo sapiens protein ( Homo sapiens cDNA FLJ39582 fis, clone SKMUS2004667. ). Length = 127 Score = 29.9 bits (64), Expect = 8.9 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +3 Query: 327 MDYRTGPYDTEYM--EHKNKITAATRNFKYFFILLF*R 434 +D+R G + E + +H+ K + RNF ++FI++F R Sbjct: 33 VDFREGYLEEESLKVQHRRKTVSQYRNFIFYFIIIFLR 70 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,100,193 Number of Sequences: 237096 Number of extensions: 1339148 Number of successful extensions: 1841 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1841 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -