Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40254
         (688 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g09990.1 68416.m01199 equilibrative nucleoside transporter, p...    29   3.8  

>At3g09990.1 68416.m01199 equilibrative nucleoside transporter,
           putative (ENT2) identical to putative equilibrative
           nucleoside transporter ENT2 [Arabidopsis thaliana]
           GI:16518991; contains similarity to SWISS-PROT:Q14542
           equilibrative nucleoside transporter 2 (Equilibrative
           nitrobenzylmercaptopurine riboside-insensitive
           nucleoside transporter, Equilibrative NBMPR-insensitive
           nucleoside transporter, Nucleoside transporter, ei-type,
           36 kDa nucleolar protein HNP36, Hydrophobic nucleolar
           protein, 36 kDa, Delayed-early response protein 12)
           [Homo sapiens]; contains Pfam profile PF01733:
           Nucleoside transporter
          Length = 417

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +1

Query: 277 IVTVTTNKRTHNYAICI-WTIGPVLMTQNTWNTKIKLLLLHGILNTFSYYYSS 432
           I+ VTTN +  NYA+ + W +G   +    WN+ + ++  +  L  F +Y+ S
Sbjct: 5   ILAVTTNPKGKNYALAVCWLLGVGCLL--AWNSMLTIVDYYAYL--FPWYHPS 53


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,827,625
Number of Sequences: 28952
Number of extensions: 197022
Number of successful extensions: 425
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 418
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 425
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1457719448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)