BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40254 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09990.1 68416.m01199 equilibrative nucleoside transporter, p... 29 3.8 >At3g09990.1 68416.m01199 equilibrative nucleoside transporter, putative (ENT2) identical to putative equilibrative nucleoside transporter ENT2 [Arabidopsis thaliana] GI:16518991; contains similarity to SWISS-PROT:Q14542 equilibrative nucleoside transporter 2 (Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter, Equilibrative NBMPR-insensitive nucleoside transporter, Nucleoside transporter, ei-type, 36 kDa nucleolar protein HNP36, Hydrophobic nucleolar protein, 36 kDa, Delayed-early response protein 12) [Homo sapiens]; contains Pfam profile PF01733: Nucleoside transporter Length = 417 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +1 Query: 277 IVTVTTNKRTHNYAICI-WTIGPVLMTQNTWNTKIKLLLLHGILNTFSYYYSS 432 I+ VTTN + NYA+ + W +G + WN+ + ++ + L F +Y+ S Sbjct: 5 ILAVTTNPKGKNYALAVCWLLGVGCLL--AWNSMLTIVDYYAYL--FPWYHPS 53 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,827,625 Number of Sequences: 28952 Number of extensions: 197022 Number of successful extensions: 425 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -