BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40253 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 25 0.78 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 24 1.4 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 1.8 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 1.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.2 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 7.3 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.6 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 24.6 bits (51), Expect = 0.78 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 598 VLRLPVEGRSFERDAAISHDVFRPMSGG 515 ++ +P GRSFE D+ P SGG Sbjct: 757 MIGMPTYGRSFELVNKTQFDIGAPASGG 784 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 598 VLRLPVEGRSFERDAAISHDVFRPMSGG 515 V+ +P GR+F V P SGG Sbjct: 328 VIGMPTYGRTFTLSNTAKFGVHAPASGG 355 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 529 PMSGGALGAVLPCGTS 482 P S G++G +PCGTS Sbjct: 216 PGSLGSMGVSVPCGTS 231 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.4 bits (48), Expect = 1.8 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -3 Query: 479 RVHAVISMLGRSIDGQSPHVVKSRIKWQTGAHPQK-HVCAEVITRCPEVIF 330 RV VIS L S +P + RIK +G ++ AEV+T P+++F Sbjct: 193 RVEEVISDLALSKCQNTPIGILGRIKGISGGEKKRLSFAAEVLTN-PKLMF 242 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.4 bits (48), Expect = 1.8 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -3 Query: 479 RVHAVISMLGRSIDGQSPHVVKSRIKWQTGAHPQK-HVCAEVITRCPEVIF 330 RV VIS L S +P + RIK +G ++ AEV+T P+++F Sbjct: 193 RVEEVISDLALSKCQNTPIGILGRIKGISGGEKKRLSFAAEVLTN-PKLMF 242 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.2 Identities = 19/72 (26%), Positives = 30/72 (41%) Frame = -3 Query: 458 MLGRSIDGQSPHVVKSRIKWQTGAHPQKHVCAEVITRCPEVIFVVTCIC*ISRYRICLLL 279 +LGR D P + G PQ+ V + C +FV ++Y +C Sbjct: 2200 ILGRDNDKTKPKPTTMKPTTTIGYEPQEPVLPAEVVPCQGRLFVADDTN-CAQYYLCNQG 2258 Query: 278 RLERCQLKPNDL 243 +L+ Q+ PN L Sbjct: 2259 QLQ-LQVCPNGL 2269 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 614 DFICEQTRCYYYNY 655 DF+C T Y+ NY Sbjct: 145 DFLCRHTVEYFQNY 158 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 381 WMSTGLPFNATFNYMRRLPIDAPAQH 458 W+ TGL +A + R I PA H Sbjct: 110 WLGTGLLTSAGPKWQNRRKILTPAFH 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,553 Number of Sequences: 336 Number of extensions: 3593 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -